BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L10 (603 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.3 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 4.0 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 21 9.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.3 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +1 Query: 421 HGSILHGTCSSDAIQLEEHHEGWNWADLXELAV 519 H I HG S ++ L H E +W E V Sbjct: 81 HHPIRHGRRQSRSMDLNAHREQMSWPVKKEAVV 113 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 132 IKELNGMMVDGQPMKVQLSTSR 197 ++ LNG+ G+P +QL + R Sbjct: 315 LRGLNGLEFAGRPQNLQLQSQR 336 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 234 CYRCGRGGHWSKECPK 281 C CG H K CPK Sbjct: 78 CGACGDIAHTVKYCPK 93 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = -3 Query: 523 KSPRAPX--DPPNSSPRDAPPTG 461 +SP+AP PPN P PP G Sbjct: 29 QSPQAPQRGSPPN--PSQGPPPG 49 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,921 Number of Sequences: 438 Number of extensions: 2664 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -