BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L09 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69979-1|CAA93819.1| 127|Anopheles gambiae vacuolar ATPase prot... 27 0.77 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 7.2 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 7.2 >Z69979-1|CAA93819.1| 127|Anopheles gambiae vacuolar ATPase protein. Length = 127 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 339 LIHHLVPNHRLPSPKKAF*VLLPSCDHSPYSVDEKS 232 LI H++ +H P+P V +PS DH PY + S Sbjct: 77 LIRHVIDSHTAPTPAD---VEIPSKDH-PYDASKDS 108 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/41 (29%), Positives = 17/41 (41%) Frame = -2 Query: 282 VLLPSCDHSPYSVDEKSP*CSFHQISVLSLAYCKMAFRQSH 160 +L+P P + + C+ SLAY FR SH Sbjct: 644 LLIPEDARGPRNQPNTALFCTILMFGTFSLAYYLKLFRNSH 684 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 444 LPPAPPCPRHYRHR 403 LPP PP PR R R Sbjct: 1078 LPPPPPSPRTERRR 1091 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,407 Number of Sequences: 2352 Number of extensions: 14220 Number of successful extensions: 235 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 235 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -