BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L07 (743 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 30 0.017 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 30 0.017 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 30 0.017 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 23 3.4 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 23 3.4 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 3.4 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 3.4 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 30.3 bits (65), Expect = 0.017 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 531 LRKSERRIKELTFQAEEDRKNHERMQDLVDKLQQKIK 641 L+K R +KE+ QA +R+ ER + + QQKI+ Sbjct: 61 LKKELRAVKEINEQARREREEQERHKQQQQEKQQKIE 97 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 30.3 bits (65), Expect = 0.017 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 531 LRKSERRIKELTFQAEEDRKNHERMQDLVDKLQQKIK 641 L+K R +KE+ QA +R+ ER + + QQKI+ Sbjct: 212 LKKELRAVKEINEQARREREEQERHKQQQQEKQQKIE 248 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 30.3 bits (65), Expect = 0.017 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 531 LRKSERRIKELTFQAEEDRKNHERMQDLVDKLQQKIK 641 L+K R +KE+ QA +R+ ER + + QQKI+ Sbjct: 271 LKKELRAVKEINEQARREREEQERHKQQQQEKQQKIE 307 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/41 (21%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +3 Query: 372 EQQIKELQVRL-DEAEANALKGGKKAIQKLEQRVRELENEL 491 +Q++ + +++ + ++ KKA+QKL + V + + +L Sbjct: 61 DQKVMDYFIKMVKQKHKKDIRADKKALQKLRREVEKAKRDL 101 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 27 GISERRANALQNELEE-SRTLLEQA 98 GI ERR+N + +EE SR +E A Sbjct: 95 GILERRSNDIAGSIEEFSRERVEDA 119 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 27 GISERRANALQNELEE-SRTLLEQA 98 GI ERR+N + +EE SR +E A Sbjct: 328 GILERRSNDIAGSIEEFSRERVEDA 352 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 27 GISERRANALQNELEE-SRTLLEQA 98 GI ERR+N + +EE SR +E A Sbjct: 328 GILERRSNDIAGSIEEFSRERVEDA 352 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.121 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,076 Number of Sequences: 336 Number of extensions: 1075 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -