BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L05 (590 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC926.04c |hsp90|swo1|heat shock protein Hsp90|Schizosaccharom... 29 0.51 SPAC22F8.11 |plc1||phosphoinositide phospholipase C Plc1|Schizos... 27 2.7 SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces po... 26 3.6 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 26 3.6 SPCC320.10 |srp72||signal recognition particle subunit Srp72|Sch... 25 6.2 SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces ... 25 8.3 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 25 8.3 >SPAC926.04c |hsp90|swo1|heat shock protein Hsp90|Schizosaccharomyces pombe|chr 1|||Manual Length = 704 Score = 29.1 bits (62), Expect = 0.51 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 157 VVAVTRVDLLRSC-QSYNEDGEQNEQFREHFEQFSK 53 ++ V R +L+R C +NE E E F+ ++ FSK Sbjct: 383 IMKVIRKNLVRRCLDMFNEIAEDKENFKTFYDAFSK 418 >SPAC22F8.11 |plc1||phosphoinositide phospholipase C Plc1|Schizosaccharomyces pombe|chr 1|||Manual Length = 899 Score = 26.6 bits (56), Expect = 2.7 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +1 Query: 1 EQIFFKSSRAGVLDHQSTLKTAQNVRETVHSVRRPRCSSGKTSTDLLWLRLQ 156 EQ FFK + D STL+ N + S + S K L WL L+ Sbjct: 59 EQDFFKMLSSRDRDAHSTLRKRSNSLSSFLSTKSTSASENKFHGGLNWLSLK 110 >SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 658 Score = 26.2 bits (55), Expect = 3.6 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 141 LVTATTITDIRIQATSVIPDTVPWPMDRTVAMLPL 245 +V TTIT + +++ +T+ PM+ T +LP+ Sbjct: 120 MVETTTITPMVEAMITLMEETMTTPMEETTTILPM 154 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 26.2 bits (55), Expect = 3.6 Identities = 17/76 (22%), Positives = 38/76 (50%) Frame = +3 Query: 291 KHLCY*FNKNILKNIMILLFISFEILINNFRGLLSIYKTPLFLSVFFSHVNYHFVNVCR* 470 +++C KN++ +++ + IS EI L + +K+ L VFF+ + + + + Sbjct: 448 QYICLALAKNVVSHVLPVFEISCEIFWLILSELKNFFKSE--LEVFFTEIFFPILEM--- 502 Query: 471 DSRGTNHESVFLFDIF 518 +N + + L +IF Sbjct: 503 -RTSSNQQKIVLLNIF 517 >SPCC320.10 |srp72||signal recognition particle subunit Srp72|Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 25.4 bits (53), Expect = 6.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 333 IMILLFISFEILINNFRGLLSIYK 404 ++ LL + +I NFRG LSIY+ Sbjct: 328 VVALLLMQHKISNGNFRGALSIYQ 351 >SPCC1450.14c |ero12||ER oxidoreductin Ero1b|Schizosaccharomyces pombe|chr 3|||Manual Length = 571 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 88 EQFREHFEQFSKLTDDLGHRR 26 E FREHF+ S L D +G R Sbjct: 375 EDFREHFKTVSALMDCVGCER 395 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 25.0 bits (52), Expect = 8.3 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = +1 Query: 52 TLKTAQNVRETVHSVRR--PRCSSGKT 126 T+ Q +R+ +H++R+ PR SS KT Sbjct: 1161 TITAEQEMRDLLHNIRQPLPRSSSSKT 1187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,840,374 Number of Sequences: 5004 Number of extensions: 33131 Number of successful extensions: 100 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -