BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L05 (590 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49540.1 68414.m05553 transducin family protein / WD-40 repea... 31 0.76 At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / hea... 29 3.1 At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 p... 28 4.1 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 28 4.1 At2g12550.1 68415.m01357 ubiquitin-associated (UBA)/TS-N domain-... 27 7.1 >At1g49540.1 68414.m05553 transducin family protein / WD-40 repeat family protein similar to signal transducer and activator of transcription interacting protein 1 (GI:15929722) {Mus musculus}; similar to hypothetical protein GB:AAD43147 GI:5430747 from (Arabidopsis thaliana); contains Pfam PF00400: WD domain, G-beta repeat (11 copies, 2 weak) Length = 840 Score = 30.7 bits (66), Expect = 0.76 Identities = 14/58 (24%), Positives = 30/58 (51%) Frame = -2 Query: 226 VRSIGQGTVSGITDVAWIRISVIVVAVTRVDLLRSCQSYNEDGEQNEQFREHFEQFSK 53 ++ + G + +TDV W R +++V++ R ++ D E NE EH+ + ++ Sbjct: 407 MQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTTRVFSAWKND-EGNEAEDEHWHELAR 463 >At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / heat shock protein 83 (HSP83) nearly identical to SP|P27323 Heat shock protein 81-1 (HSP81-1) (Heat shock protein 83) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 705 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 157 VVAVTRVDLLRSC-QSYNEDGEQNEQFREHFEQFSK 53 ++ V R +L++ C + +NE E E + + +E FSK Sbjct: 385 ILKVIRKNLVKKCIEMFNEIAENKEDYTKFYEAFSK 420 >At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 909 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 120 QDLNRSTLVTATTITDIRIQATSVIPDTVPWPMDRTVA 233 + +N +TLVTA I A +PDT W M T+A Sbjct: 689 ESVNYATLVTARLIIVASHMAGLGLPDTEAWNMIETIA 726 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 120 QDLNRSTLVTATTITDIRIQATSVIPDTVPWPMDRTVA 233 + +N +TLVTA I A +PDT W M T+A Sbjct: 689 ESVNYATLVTARLIIVASHMAGLGLPDTEAWNMIETIA 726 >At2g12550.1 68415.m01357 ubiquitin-associated (UBA)/TS-N domain-containing protein low similarity to NUB1 (NEDD8-interacting protein) [Homo sapiens] GI:13383476; contains Pfam profile PF00627: UBA/TS-N domain Length = 562 Score = 27.5 bits (58), Expect = 7.1 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 8/99 (8%) Frame = -2 Query: 289 RKYQLVAVAVAEVV----WRGSIATVRSIGQGTVSGITDVAWIRISVIVVAVTRVDLLRS 122 R+ QLV ++VAE+V RG + G I + + SV T ++ + Sbjct: 412 RQEQLVGISVAELVSMGFERGKATSALEAGGSREDTIQRL--LSASVANPGTTTTSVINA 469 Query: 121 CQSYNEDGEQNEQFREHFEQFSKL----TDDLGHRRVTT 17 S N G ++ F EQ S++ TDD+ +R T+ Sbjct: 470 TSSTNNVGAESSGFGGGAEQDSEMKDETTDDIANRASTS 508 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,134,056 Number of Sequences: 28952 Number of extensions: 159067 Number of successful extensions: 471 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 471 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -