BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L04 (432 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25140.1 68416.m03139 glycosyl transferase family 8 protein c... 27 4.1 At3g02350.1 68416.m00218 glycosyl transferase family 8 protein c... 27 5.5 >At3g25140.1 68416.m03139 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 559 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 186 FTPYHRYSYYNNISI*VKLETFNPK 260 F +HRY+ Y N S + E FNPK Sbjct: 413 FGSFHRYAQYMNFSHPLIKEKFNPK 437 >At3g02350.1 68416.m00218 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 561 Score = 27.1 bits (57), Expect = 5.5 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 150 NLDFK-RTSLNKFFTPYHRYSYYNNISI*VKLETFNPKLTLTYFS*DTF 293 NLD K ++ F +HRY Y N S + E FNP F + F Sbjct: 402 NLDGKVNGAVETCFGSFHRYGQYLNFSHPLIKENFNPSACAWAFGMNIF 450 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,714,930 Number of Sequences: 28952 Number of extensions: 76574 Number of successful extensions: 88 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 685039728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -