Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P02_F_L03
         (507 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4P4S9 Cluster: Putative uncharacterized protein; n=1; ...    32   6.5  

>UniRef50_Q4P4S9 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 577

 Score = 32.3 bits (70), Expect = 6.5
 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = -3

Query: 256 ITGWHRAL-FR*LFSNNH--LYNSKCRSQIITLKLNYTIKLKWKS*WRLIQYQSHILHST 86
           +  WHR L +   ++ NH  + +   R+++    +   ++  WK+ W  I   + I+HST
Sbjct: 192 VNKWHRGLRYMANWAKNHTNIVSMSLRNELRKSAIEPNLEYNWKTWWGNISEAAEIIHST 251

Query: 85  N 83
           N
Sbjct: 252 N 252


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 268,489,381
Number of Sequences: 1657284
Number of extensions: 3971749
Number of successful extensions: 7035
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6930
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7034
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 30528237263
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)