BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_L03 (507 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0647 - 4909311-4909412,4909538-4909610,4909930-4910047,491... 32 0.23 >01_01_0647 - 4909311-4909412,4909538-4909610,4909930-4910047, 4910133-4910229,4910350-4910445,4910536-4910631, 4910725-4910871,4911877-4911987,4912582-4912620 Length = 292 Score = 32.3 bits (70), Expect = 0.23 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = -3 Query: 241 RALFR*LFSNNHLYNSKCRSQIITLKLNYTIKLKWKS*W----RLIQYQSHILHSTNVQF 74 + L R F + +L K + I+ LK+ + +LK R ++ QSH+ H ++ Sbjct: 33 KPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLKQSQVEHQLRREVEIQSHLRHPNILRL 92 Query: 73 YMYLYDKTK 47 Y Y YD+T+ Sbjct: 93 YGYFYDQTR 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,685,653 Number of Sequences: 37544 Number of extensions: 91278 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -