BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_K22 (823 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 25 1.1 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 25 1.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 4.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 6.0 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 614 VINVPPRNSQLPRSA--SIAAAEKHTNTRVVPSRAVIMIDGSTTLTYSSR 471 V+N+ ++ + R++ S+ + V+ +R V+ DGS T YSS+ Sbjct: 545 VVNLKSGSNTIERNSHESVFVVPDEVPSDVLYNRLVVSEDGSETFKYSSQ 594 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 24.6 bits (51), Expect = 1.1 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 614 VINVPPRNSQLPRSA--SIAAAEKHTNTRVVPSRAVIMIDGSTTLTYSSR 471 V+N+ ++ + R++ S+ + V+ +R V+ DGS T YSS+ Sbjct: 545 VVNLKSGSNTIERNSHESVFVVPDEVPSDVLYNRLVVSEDGSETFKYSSQ 594 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 4.5 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -2 Query: 240 NWWFQSILKAVDKGLKI 190 NW Q ++K+++KG ++ Sbjct: 841 NWSNQDVIKSIEKGYRL 857 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 6.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 518 AVIMIDGSTTLTYSSRGPMLMPDVNPNP 435 A I++ T Y++ P L +NPNP Sbjct: 198 APILVRARETPNYTACPPTLACPLNPNP 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,835 Number of Sequences: 438 Number of extensions: 4521 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -