BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_K12 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 1.7 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 24 1.7 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.2 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 2.9 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 2.9 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.9 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 2.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.9 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 22 5.1 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 6.8 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 6.8 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 6.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 6.8 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 6.8 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 6.8 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 6.8 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 9.0 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.0 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 568 TRNTLYFNTIYSNYXNHQKYYS 633 + T++ N Y+NY N + YY+ Sbjct: 308 SNKTIHNNNNYNNYNNKKLYYN 329 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.8 bits (49), Expect = 1.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 556 SYNSTRNTLYFNTIYSNYXNHQKYYSTWNFSST 654 +Y+S NTL + + SN + K+ + N SST Sbjct: 300 AYSSLENTLKYYEVGSNVPFNFKFITDANSSST 332 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 538 YKSHIYSYNSTRNTLYFNTIYSNYXNHQK--YYSTWN 642 + ++ Y YN N N +NY N+ K YY+ N Sbjct: 324 HNNNNYKYNYNNNNYNNNNYNNNYNNNCKKLYYNIIN 360 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 2.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 529 N*KYKSHIYSYNSTRNTLYFNTIYSNYXNHQKYY 630 N KY S+ +YN+ N Y N +NY K Y Sbjct: 88 NYKY-SNYNNYNNNYNNNYNNNYNNNYKKLYKNY 120 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.0 bits (47), Expect = 2.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 529 N*KYKSHIYSYNSTRNTLYFNTIYSNYXNHQKYY 630 N KY S+ +YN+ N Y N +NY K Y Sbjct: 88 NYKY-SNYNNYNNNYNNNYNNNYNNNYKKLYKNY 120 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.9 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 550 IYSYNSTRNTLYFNTIYSNY-XNHQKYYSTWNFSSTIN 660 I + NS N +N Y+NY N+ Y + + IN Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNNNYNTNYKKLQYYNIIN 119 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYSTWN 642 ++L N YSNY N+ Y+ +N Sbjct: 83 SSLSNNYNYSNYNNYNNNYNNYN 105 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYSTWN 642 ++L N YSNY N+ Y+ +N Sbjct: 316 SSLSNNYKYSNYNNYNNNYNNYN 338 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 717 LVPVLLNNVINKCPAIMLAVNRT 649 L+P +LNN N+C + + + T Sbjct: 56 LLPEVLNNHCNRCTSRQIGIANT 78 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYST 636 ++L N YSNY N+ Y+T Sbjct: 83 SSLSNNYKYSNYNNYNNNYNT 103 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYST 636 ++L N YSNY N+ Y+T Sbjct: 83 SSLSNNYKYSNYNNYNNNYNT 103 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYST 636 ++L N YSNY N+ Y+T Sbjct: 83 SSLSNNYKYSNYNNYNNNYNT 103 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYST 636 ++L N YSNY N+ Y+T Sbjct: 83 SSLSNNYKYSNYNNYNNNYNT 103 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYST 636 ++L N YSNY N+ Y+T Sbjct: 83 SSLSNNYKYSNYNNYNNNYNT 103 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYST 636 ++L N YSNY N+ Y+T Sbjct: 83 SSLSNNYKYSNYNNYNNNYNT 103 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYST 636 ++L N YSNY N+ Y+T Sbjct: 83 SSLSNNYKYSNYNNYNNNYNT 103 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +1 Query: 556 SYNSTRNTLYFNTIYSNY 609 S+ T N YF+ Y NY Sbjct: 209 SWRITHNFFYFDPRYGNY 226 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 574 NTLYFNTIYSNYXNHQKYYSTWN 642 ++L NTI++N N + YY+ N Sbjct: 316 SSLSNNTIHNNNYNKKLYYNIIN 338 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,481 Number of Sequences: 438 Number of extensions: 2260 Number of successful extensions: 26 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -