BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_K08 (486 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) 134 5e-32 SB_45659| Best HMM Match : E_Pc_C (HMM E-Value=1.2) 27 6.2 >SB_27622| Best HMM Match : Ribosomal_S25 (HMM E-Value=0) Length = 115 Score = 134 bits (323), Expect = 5e-32 Identities = 68/115 (59%), Positives = 78/115 (67%) Frame = +2 Query: 20 PPKKDAKASAKQPQXXXXXXXXXXXXXXXXXXXXXXXXXXXLNNQVLFDKPTYEKLYKEV 199 PPKKD K AK+PQ LNN VLFDK TY+KLYKEV Sbjct: 1 PPKKDPKKDAKKPQKAQKPAGSGGGKAKKKKWSKGKVRDK-LNNLVLFDKATYDKLYKEV 59 Query: 200 PQYKLITPAVVSERLKVRGSLARRALIELREKGLIKQVVQHHGQVIYTRATKGDD 364 P Y+LITP+VVSERLK+RGSLARRAL+EL+ KGLIK+V +HH Q+IYTRATKG D Sbjct: 60 PSYRLITPSVVSERLKIRGSLARRALLELQSKGLIKEVSKHHSQLIYTRATKGAD 114 >SB_45659| Best HMM Match : E_Pc_C (HMM E-Value=1.2) Length = 1244 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 198 TSLYSFSYVGLSNNTWLFNLSRTFPLDH 115 +SL+ G+SN+ WL N S T P++H Sbjct: 250 SSLHIEKENGISNDDWLSNPSFTSPIEH 277 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,824,986 Number of Sequences: 59808 Number of extensions: 276313 Number of successful extensions: 895 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 893 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -