BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_K04 (726 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0293 - 28254673-28254878,28255189-28255306,28255767-282559... 30 1.6 01_06_1665 - 38988014-38988078,38988459-38988546,38988921-389890... 28 8.7 01_01_1206 - 9702128-9702184,9702272-9702323,9702410-9702471,970... 28 8.7 >01_06_0293 - 28254673-28254878,28255189-28255306,28255767-28255961, 28256701-28256800,28256887-28256972,28257078-28257239, 28257965-28258101,28258233-28258281,28258688-28258746, 28258862-28258896,28259384-28259433,28260173-28260332, 28260898-28260963,28261065-28261162,28261649-28261696, 28262114-28262242,28262667-28262769,28262858-28262954, 28263181-28263241,28263659-28263740,28263845-28263962, 28264039-28266325 Length = 1481 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/64 (26%), Positives = 33/64 (51%) Frame = -2 Query: 515 ARKPELLNFVEELDTVRLHMVLVEKLASICLFLGDIGSLVCNHKSSRLFGLPDRTIRCPD 336 +R P+L+ ++EL ++ + +++ IC+F+ DI + CN +S L R D Sbjct: 1058 SRFPDLVGMIKELCSIEVSSFILDAEVDICVFVFDI--MFCNGQSLLNCSLRQRRKYIHD 1115 Query: 335 ILPE 324 + E Sbjct: 1116 LFQE 1119 >01_06_1665 - 38988014-38988078,38988459-38988546,38988921-38989082, 38989268-38989359,38989896-38990007,38990040-38990181, 38990448-38990668 Length = 293 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 187 FEYYISNMCIVSNINSTKQLKRCYRIPGNGRK 282 ++Y+ + + + S N TK LK+ + P GRK Sbjct: 173 YDYFSTALYLYSKYNVTKALKKAHIYPRGGRK 204 >01_01_1206 - 9702128-9702184,9702272-9702323,9702410-9702471, 9702578-9702665,9703027-9703095,9703224-9703281, 9703895-9703996,9704075-9704179,9704273-9704624, 9706005-9706100,9706427-9706501,9707192-9707370, 9707501-9707740,9707922-9708017,9708193-9708306, 9708428-9708527 Length = 614 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 332 RCPDNELFYPGDQKDDWICDCRPANLYHPGTDKC 433 RC D + D+ +D CDC P PGT C Sbjct: 44 RCRDGSGRFARDKLNDDFCDC-PDGTDEPGTSAC 76 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,053,462 Number of Sequences: 37544 Number of extensions: 400170 Number of successful extensions: 992 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -