BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_K03 (781 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 22 4.8 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 22 4.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.4 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 22.2 bits (45), Expect = 4.8 Identities = 15/55 (27%), Positives = 21/55 (38%) Frame = -2 Query: 690 YSRISENT*LPRIQSQSKGTSPTQFLGQY*TGVPKHQYTDCTGPHTSLFGSLQPS 526 YS S + P+ S S TSP + Y + H + GS+ PS Sbjct: 35 YSSSSPSGSSPQHSSSSASTSPAARMYPYVSAAHHHHQAAAAAFGAAASGSMVPS 89 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 22.2 bits (45), Expect = 4.8 Identities = 15/55 (27%), Positives = 21/55 (38%) Frame = -2 Query: 690 YSRISENT*LPRIQSQSKGTSPTQFLGQY*TGVPKHQYTDCTGPHTSLFGSLQPS 526 YS S + P+ S S TSP + Y + H + GS+ PS Sbjct: 35 YSSSSPSGSSPQHSSSSASTSPAARMYPYVSAAHHHHQAAAAAFGAAASGSMVPS 89 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 Query: 408 NMDLHYIRPNGVDLRSFDDQVPEDTRTFDHVNFNQN 515 N +HY G D R +P ++F + NQN Sbjct: 2045 NFTIHYWIEKGADRRKLVMGMPMYGQSFSLADNNQN 2080 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,505 Number of Sequences: 336 Number of extensions: 3879 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -