BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_J23 (552 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 28 0.23 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 25 1.3 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 25 1.3 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 25 1.3 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 2.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 8.8 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 27.9 bits (59), Expect = 0.23 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 531 SLHSVRSSHSRAIRTKSSSEWVLI 460 SLH VR+S + I +SSS W+++ Sbjct: 2 SLHFVRTSTTHGINMRSSSVWLIV 25 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 25.4 bits (53), Expect = 1.3 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -3 Query: 490 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 347 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 312 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 358 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 25.4 bits (53), Expect = 1.3 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -3 Query: 490 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 347 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 288 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 334 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 25.4 bits (53), Expect = 1.3 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -3 Query: 490 DQILFRMGFDWVKAQTLVLVLVQT*SSEGVLVDDQTVQDLGRQTNIPH 347 D +LF +G + TL L ++EG D V + +TN+PH Sbjct: 285 DTVLFAIGRQ-AETGTLKLANAGVVTAEGGKSDKLEVDETDHRTNVPH 331 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 24.6 bits (51), Expect = 2.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 447 WAFTQSKPIRKRIWSG 494 W F Q+KP R R W+G Sbjct: 162 WQFPQTKPKRIRGWTG 177 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 8.8 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -1 Query: 447 KHWSWSWSKHE 415 + W W WSK E Sbjct: 2852 RFWEWDWSKPE 2862 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 560,325 Number of Sequences: 2352 Number of extensions: 11049 Number of successful extensions: 28 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -