BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_J22 (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_17018| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 >SB_15253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 29.1 bits (62), Expect = 2.2 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -2 Query: 339 GTSPSQFQLRRSSHYHNRNILE 274 G+SP+++Q+R+ H+H R +E Sbjct: 34 GSSPAKYQVRKGIHFHRRKPIE 55 >SB_17018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 27.5 bits (58), Expect = 6.6 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 142 LSFCVEPSL*NRVAMRSVLLFSTPNLFILLHNRIIA 35 L FCV+ +RVAM S L+ S+P L R +A Sbjct: 621 LDFCVDHPTDDRVAMASTLIQSSPCLRTHFERRCLA 656 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,076,628 Number of Sequences: 59808 Number of extensions: 243847 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -