BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_J22 (502 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X99726-1|CAB56704.1| 108|Homo sapiens mitochondrial NADH-Ubiqui... 36 0.060 CR542190-1|CAG46987.1| 108|Homo sapiens NDUFV3 protein. 36 0.060 CR542174-1|CAG46971.1| 108|Homo sapiens NDUFV3 protein. 36 0.060 BC054016-1|AAH54016.1| 108|Homo sapiens NADH dehydrogenase (ubi... 36 0.060 BC033766-1|AAH33766.1| 108|Homo sapiens NADH dehydrogenase (ubi... 36 0.060 AB038163-1|BAB13732.1| 108|Homo sapiens NADH-Ubiquinone oxidore... 36 0.060 BC021217-1|AAH21217.2| 473|Homo sapiens NADH dehydrogenase (ubi... 34 0.24 AK056041-1|BAB71080.1| 456|Homo sapiens protein ( Homo sapiens ... 34 0.24 AY173949-1|AAO49719.1| 112|Homo sapiens mitochondrial NADH oxid... 34 0.32 >X99726-1|CAB56704.1| 108|Homo sapiens mitochondrial NADH-Ubiquinone oxidoreductase 10-kDa subunit protein. Length = 108 Score = 36.3 bits (80), Expect = 0.060 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 216 PASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 P +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 54 PPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 101 >CR542190-1|CAG46987.1| 108|Homo sapiens NDUFV3 protein. Length = 108 Score = 36.3 bits (80), Expect = 0.060 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 216 PASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 P +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 54 PPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 101 >CR542174-1|CAG46971.1| 108|Homo sapiens NDUFV3 protein. Length = 108 Score = 36.3 bits (80), Expect = 0.060 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 216 PASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 P +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 54 PPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 101 >BC054016-1|AAH54016.1| 108|Homo sapiens NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa protein. Length = 108 Score = 36.3 bits (80), Expect = 0.060 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 216 PASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 P +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 54 PPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 101 >BC033766-1|AAH33766.1| 108|Homo sapiens NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa protein. Length = 108 Score = 36.3 bits (80), Expect = 0.060 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 216 PASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 P +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 54 PPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 101 >AB038163-1|BAB13732.1| 108|Homo sapiens NADH-Ubiquinone oxidoreductase protein. Length = 108 Score = 36.3 bits (80), Expect = 0.060 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 216 PASQPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 P +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 54 PPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 101 >BC021217-1|AAH21217.2| 473|Homo sapiens NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa protein. Length = 473 Score = 34.3 bits (75), Expect = 0.24 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +3 Query: 225 QPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 422 EPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 466 >AK056041-1|BAB71080.1| 456|Homo sapiens protein ( Homo sapiens cDNA FLJ31479 fis, clone NT2NE2001634, moderately similar to NADH-UBIQUINONE OXIDOREDUCTASE 9 KD SUBUNIT PRECURSOR ). Length = 456 Score = 34.3 bits (75), Expect = 0.24 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +3 Query: 225 QPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 405 EPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 449 >AY173949-1|AAO49719.1| 112|Homo sapiens mitochondrial NADH oxidoreductase-like protein protein. Length = 112 Score = 33.9 bits (74), Expect = 0.32 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +3 Query: 225 QPVGPGVDPKKTGAYKVPEYFCYDNVSFFEAEIEMAKYRLPQPSA 359 +P +P YK ++ Y +F + +E++K+R+PQPS+ Sbjct: 61 KPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSS 105 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,683,756 Number of Sequences: 237096 Number of extensions: 1308724 Number of successful extensions: 2328 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2328 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4593178062 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -