BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_J19 (786 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 2.4 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 5.6 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -3 Query: 427 SRDDLRAAGLQEYGLLQRLQHVVNNFRNPLSGYIHRICG 311 SRD L + + + Q ++H+ + + P IH + G Sbjct: 304 SRDFLSSLAFRVFQSTQYIRHIKSPYHTPEPDCIHELLG 342 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 429 IPAMTCALRVCRNMG 385 + ++TCAL+ C N G Sbjct: 161 LKSITCALQFCHNAG 175 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,790 Number of Sequences: 438 Number of extensions: 4367 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -