BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_J17 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC343.16 |lys2||homoaconitate hydratase Lys2|Schizosaccharomyc... 28 1.00 SPBC4.04c |mcm2|cdc19, nda1|MCM complex subunit Mcm2 |Schizosacc... 27 1.7 SPBC8E4.04 |||aldo/keto reductase involved in pentose catabolism... 26 5.3 SPBC14C8.16c |bot1||mitochondrial ribosomal protein subunit S35 ... 25 7.0 >SPAC343.16 |lys2||homoaconitate hydratase Lys2|Schizosaccharomyces pombe|chr 1|||Manual Length = 721 Score = 28.3 bits (60), Expect = 1.00 Identities = 16/57 (28%), Positives = 33/57 (57%) Frame = +3 Query: 462 KATLDDGEKVPIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLSQNIQEDDL 632 + TLD + PI L +GAF ++ + D +T+ + +SV++YN + +++ D+ Sbjct: 313 RETLDAIKASPI--LADEGAFYAKHLILDLSTLSPAVSGPNSVKVYNSAATLEKKDI 367 >SPBC4.04c |mcm2|cdc19, nda1|MCM complex subunit Mcm2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 830 Score = 27.5 bits (58), Expect = 1.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 589 TDDSIVDRANTVAQSRTVDSLSKAPCVSNNIIGTFSPS 476 TDD T + R + +L+K+P + N II + +PS Sbjct: 458 TDDDFSLSRLTDDEEREIRALAKSPDIHNRIIASMAPS 495 >SPBC8E4.04 |||aldo/keto reductase involved in pentose catabolism |Schizosaccharomyces pombe|chr 2|||Manual Length = 325 Score = 25.8 bits (54), Expect = 5.3 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +3 Query: 468 TLDDGEKVPIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLSQNIQE 623 TL +G+K+P I L T + E+ CA + A + + IY + I E Sbjct: 16 TLPNGDKIPSIGLGTWRSGKDETKNAVCAALKAGYRHIDTAHIYGNEKEIGE 67 >SPBC14C8.16c |bot1||mitochondrial ribosomal protein subunit S35 |Schizosaccharomyces pombe|chr 2|||Manual Length = 315 Score = 25.4 bits (53), Expect = 7.0 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = +2 Query: 41 PVINKLNMAENEGHKHRERYDH----EGEVTEKPAPAPRGPHGVQVVDTGPDHTFTLXRG 208 P I +LNM +N H H+ +H E E +P+ G +++D + + G Sbjct: 244 PSIEELNMRQNATHFHKTSDEHKDLNEDEELISSSPSEVGKRVFRLIDLSTGNVYRRDTG 303 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,375,560 Number of Sequences: 5004 Number of extensions: 45454 Number of successful extensions: 146 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -