BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_J14 (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.03c |rdl1||RAD51D-like protein 1|Schizosaccharomyces po... 27 2.1 SPCC126.07c |||human CTD-binding SR-like protein rA9 homolog|Sch... 25 8.4 >SPAC17H9.03c |rdl1||RAD51D-like protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 26.6 bits (56), Expect = 2.1 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +2 Query: 59 RQASFVSFSICTVQSVPSQSLSFFVATNKLPFCDDQEF*FAGQQHIRC--*CYSTRRD 226 R A ++S S+ ++ + LS N PFC D + QQH +C C +R+D Sbjct: 124 RLAVYLSTSLVYIKQL---HLSKPALGNSWPFCLDHSYILEDQQHNKCLVHCNQSRKD 178 >SPCC126.07c |||human CTD-binding SR-like protein rA9 homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 571 Score = 24.6 bits (51), Expect = 8.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 78 RFQSVPCKVFHHNHC 122 R +PC + HNHC Sbjct: 50 RIAKIPCGHYFHNHC 64 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,767,194 Number of Sequences: 5004 Number of extensions: 33334 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -