BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_J14 (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) 29 2.2 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 >SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) Length = 1332 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 229 RLWRSEHFSLLGGKKGRFPHRTELKARIGEDSSRT*CSGKIIL 357 +LW F + G KKG FP+ ++ R+ + + CS +IL Sbjct: 1080 QLWLLSRFKINGTKKGCFPYNKQIFWRLNKVKKKE-CSHTVIL 1121 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 66 LVLSRFQSVPCKVFHHNHCRF 128 L RF S+ C +FH NH F Sbjct: 508 LTFERFLSITCPIFHRNHVTF 528 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,003,700 Number of Sequences: 59808 Number of extensions: 267276 Number of successful extensions: 544 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 544 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -