BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_J03 (761 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13169| Best HMM Match : Band_7 (HMM E-Value=1.4013e-45) 183 1e-46 SB_8661| Best HMM Match : Band_7 (HMM E-Value=3.7e-16) 159 3e-39 SB_4460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_31694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_17953| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_16268| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 >SB_13169| Best HMM Match : Band_7 (HMM E-Value=1.4013e-45) Length = 242 Score = 183 bits (446), Expect = 1e-46 Identities = 84/149 (56%), Positives = 112/149 (75%) Frame = +1 Query: 214 SQSVFTVEGGHRAIMFNRIGGVQQHVFTEGMHFRIPWFQYPIIYDIRSRPRKISSPTGSK 393 + ++F V+GGHRA++F+R GV+ V EG HF IPW Q PII+DIR+RPR + TGSK Sbjct: 24 NSALFNVDGGHRAVIFDRFQGVKPDVVGEGTHFLIPWVQRPIIFDIRTRPRNVPVTTGSK 83 Query: 394 DLQMVNISLRVLSRPDANMLATMYRQLGTDYDEKVLPSICNEVLKSVVAKFNASQLITQR 573 DLQ VNI+LR+L RP +L +Y LG DYDE+VLPSI EVLK+VVA+F+A +LITQR Sbjct: 84 DLQNVNITLRILYRPQPQVLPKIYMNLGEDYDERVLPSITTEVLKAVVAQFDAGELITQR 143 Query: 574 QQVSLLIRRELVERAADFNIILDDVSLTE 660 + VS ++ +L ERA+ F ++LDD+SL E Sbjct: 144 EMVSQKVQEDLTERASSFGLVLDDISLAE 172 >SB_8661| Best HMM Match : Band_7 (HMM E-Value=3.7e-16) Length = 500 Score = 159 bits (385), Expect = 3e-39 Identities = 78/97 (80%), Positives = 88/97 (90%) Frame = +1 Query: 394 DLQMVNISLRVLSRPDANMLATMYRQLGTDYDEKVLPSICNEVLKSVVAKFNASQLITQR 573 DLQMVNI LRVL+RP+AN L MYR+LG D+DE+VLPSI NEVLKSVVA+FNASQLIT R Sbjct: 357 DLQMVNIGLRVLARPEANKLPPMYRKLGLDFDERVLPSIMNEVLKSVVAQFNASQLITMR 416 Query: 574 QQVSLLIRRELVERAADFNIILDDVSLTELSFGKEYT 684 QQVSLLIRR+L+ERA DF IILDDVS+T+LSFGKEYT Sbjct: 417 QQVSLLIRRQLMERARDFYIILDDVSITDLSFGKEYT 453 >SB_4460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 685 Score = 28.3 bits (60), Expect = 7.2 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 427 LSRPDANMLATMYRQL-GTDYDEKVLPSICNEVLKSVVAKFNASQLITQRQQV 582 + R A ++A Y QL G DYDE P + L+S++A N L + V Sbjct: 587 VDRYKARLVAQGYSQLKGVDYDEVFSPVTRSASLRSLLALANVHDLEVHQMDV 639 >SB_26085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 433 EKALGGKCLPSVNLLNQSGKISCEVGI*YH 344 E ALG C N +N G C+ G YH Sbjct: 329 ECALGATCPSGTNCVNTQGSFYCDCGHGYH 358 >SB_31694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -1 Query: 650 DTSSRIILKSAARSTNSLLISRDTC*RCVISWEALNLATTDFRTSL 513 DTS +L STNSL DTC ++ ++N D+ TS+ Sbjct: 156 DTSMNSLLHDYDTSTNSLPYDYDTCTHSLLYDISMNSLLYDYDTSM 201 >SB_17953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 8/53 (15%) Frame = -3 Query: 366 ARSGSDIINDGVLKPRYTEVHTFGE--------YVLLYSSYSVEHNGTMTSFH 232 A++GS I G+ +PR+ V + + LY+++SV +N T+TS H Sbjct: 529 AQTGSFKITSGINRPRHVFVWISNDANENSQTVHPFLYNTFSVANNRTLTSCH 581 >SB_16268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 8/53 (15%) Frame = -3 Query: 366 ARSGSDIINDGVLKPRYTEVHTFGE--------YVLLYSSYSVEHNGTMTSFH 232 A++GS I G+ +PR+ V + + LY+++SV +N T+TS H Sbjct: 15 AQTGSFKITSGINRPRHVFVWISNDANENSQTVHPFLYNTFSVANNRTLTSCH 67 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,631,118 Number of Sequences: 59808 Number of extensions: 445728 Number of successful extensions: 1459 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1457 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -