BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_I23 (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 25 0.70 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 25 0.70 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.7 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.6 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 25.0 bits (52), Expect = 0.70 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -3 Query: 346 MFLRYFF**--SK*LRDTT*TISNTTESLKI*SFKTTNIKLKVYLIY 212 +FL YFF K L + +S E+L K I+ KVYL+Y Sbjct: 82 VFLTYFFNILFRKKLLNAVKILSKIDETLNSKPLKPVKIRTKVYLVY 128 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 25.0 bits (52), Expect = 0.70 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -3 Query: 346 MFLRYFF**--SK*LRDTT*TISNTTESLKI*SFKTTNIKLKVYLIY 212 +FL YFF K L + +S E+L K I+ KVYL+Y Sbjct: 78 VFLTYFFNILFRKKLLNAVKILSKIDETLNSKPLKPVKIRTKVYLVY 124 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -3 Query: 514 HCDWPAN 494 HCDWP N Sbjct: 2275 HCDWPEN 2281 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 8.6 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 Query: 511 CDWPANRPNKYVMTSAKTIKR 449 CDWP N T+A KR Sbjct: 960 CDWPENVEGCMQHTAAPPTKR 980 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 501 GQSQWLDSIAKTLGYQSEYHYA 566 G+ +WL ++ GY+ EY A Sbjct: 578 GEDRWLCTLLLQRGYRVEYSAA 599 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 501 GQSQWLDSIAKTLGYQSEYHYA 566 G+ +WL ++ GY+ EY A Sbjct: 838 GEDRWLCTLLLQRGYRVEYSAA 859 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 501 GQSQWLDSIAKTLGYQSEYHYA 566 G+ +WL ++ GY+ EY A Sbjct: 838 GEDRWLCTLLLQRGYRVEYSAA 859 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 501 GQSQWLDSIAKTLGYQSEYHYA 566 G+ +WL ++ GY+ EY A Sbjct: 811 GEDRWLCTLLLQRGYRVEYSAA 832 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 501 GQSQWLDSIAKTLGYQSEYHYA 566 G+ +WL ++ GY+ EY A Sbjct: 811 GEDRWLCTLLLQRGYRVEYSAA 832 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 501 GQSQWLDSIAKTLGYQSEYHYA 566 G+ +WL ++ GY+ EY A Sbjct: 838 GEDRWLCTLLLQRGYRVEYSAA 859 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 501 GQSQWLDSIAKTLGYQSEYHYA 566 G+ +WL ++ GY+ EY A Sbjct: 838 GEDRWLCTLLLQRGYRVEYSAA 859 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,233 Number of Sequences: 336 Number of extensions: 2778 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -