BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_I16 (739 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.84 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 1.1 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 7.9 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 7.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 0.84 Identities = 12/45 (26%), Positives = 18/45 (40%) Frame = +3 Query: 489 SRTRSVWTSSPTN*KRPVSSPRTLTENPTRFRENWPSLKTNSKSP 623 S T S W ++ T + + P T + NWP+ T P Sbjct: 1045 STTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPTQGTTIPPP 1089 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 24.2 bits (50), Expect = 1.1 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 513 SSPTN*KRPV-SSPRTLTENPTRFRENWPSLKTNSK 617 +SPT P SSPR+++E+P R+ P+ + NS+ Sbjct: 53 ASPTPGDVPTPSSPRSISEDPLNCRD-LPNSRCNSR 87 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/51 (23%), Positives = 22/51 (43%) Frame = +2 Query: 383 EKSEERSGTAQQKLLEAQQSADENNRMCKVLENRAQQDEERMDQLTNQLKE 535 +K++E G K ++ EN+ K+ +DE+ +N KE Sbjct: 855 DKAQEADGEVVVKKEVDEEERLENHTSVKIKREAEDRDEDERSFHSNGAKE 905 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 205 RGSPRTPEEARPGGGRPDPEQE 270 RG PRTP + + G+ P+++ Sbjct: 58 RGPPRTPLQPKLVAGKLKPKRQ 79 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 Query: 272 CSCSGSGLPPPGRASSGVRGLPRLPSQHG 186 C G P PG S V G P + S HG Sbjct: 131 CLSGGPKHPDPG--SLQVPGAPMMMSSHG 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,595 Number of Sequences: 336 Number of extensions: 2859 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -