BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_I13 (813 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.04 |rpl2502|rpl25b, rpl23a-2|60S ribosomal protein L25|S... 55 1e-08 SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosacch... 54 3e-08 SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pom... 27 4.2 SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 26 5.5 >SPBC4F6.04 |rpl2502|rpl25b, rpl23a-2|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 55.2 bits (127), Expect = 1e-08 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = +1 Query: 664 VTKALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKSL 807 V KA AQ+ V KG H K RK+R S FRRPKT E R PKY RKS+ Sbjct: 3 VGKAKGAQKTVQKGIHNKVARKVRTSTTFRRPKTLELARKPKYARKSV 50 >SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 53.6 bits (123), Expect = 3e-08 Identities = 26/48 (54%), Positives = 31/48 (64%) Frame = +1 Query: 664 VTKALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKSL 807 V KA AQ+ V KG H K +K+R S FRRPKT + R PKY RKS+ Sbjct: 3 VAKAKGAQKTVQKGIHNKVAKKVRTSTTFRRPKTLQLSRKPKYARKSV 50 >SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1185 Score = 26.6 bits (56), Expect = 4.2 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +3 Query: 9 RCLCHDATEEATRE--IR-VLRVQTRGKET 89 +C CHDAT E TR IR ++ + RG +T Sbjct: 426 KCTCHDATYEYTRRKMIRSLIEFRVRGVKT 455 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 26.2 bits (55), Expect = 5.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 564 SQNCQTQASSFQIEDCTEAQKDWD*GTKKS 653 S+NCQ + +++C EA D D G K+ Sbjct: 479 SENCQKLSKQIPLDECNEALFDDDNGDYKA 508 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,617,928 Number of Sequences: 5004 Number of extensions: 21945 Number of successful extensions: 61 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 396433620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -