BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_I13 (813 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57676| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20380| Best HMM Match : Lipase_GDSL (HMM E-Value=0.24) 29 3.4 SB_32271| Best HMM Match : Antimicrobial18 (HMM E-Value=1.6) 29 5.9 >SB_57676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KA KA++ V KG + +K+R SV F RPKT R+PKYPR S Sbjct: 138 KAQKAKKAVQKGVRAAKTKKVRTSVKFHRPKTLSLRRNPKYPRTS 182 >SB_20380| Best HMM Match : Lipase_GDSL (HMM E-Value=0.24) Length = 416 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +3 Query: 552 CGNSSQNCQTQASSFQIEDCTEAQKDWD*GTKKSSETCY*ST*GSEEGCK 701 CGN + NC +A + E + DW +ETC SEE C+ Sbjct: 129 CGNGTSNCNCEACTDFSEVISAELYDW----VPQNETCVVKNYSSEEACR 174 >SB_32271| Best HMM Match : Antimicrobial18 (HMM E-Value=1.6) Length = 154 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 780 PRRFKRLGSAEMHRXANFPYSLPMFTFYNLPLSL 679 PRR +R+ ++ + N P + +F +YNL + L Sbjct: 49 PRRCRRVSDEQVEKSPNEPKAQSLFLWYNLAIRL 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,508,128 Number of Sequences: 59808 Number of extensions: 165798 Number of successful extensions: 509 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 505 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -