BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_I13 (813 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43701-1|AAB03210.1| 156|Homo sapiens ribosomal protein L23a pr... 58 4e-08 U37230-1|AAB17510.1| 156|Homo sapiens ribosomal protein L23a pr... 58 4e-08 U02032-1|AAA03341.1| 156|Homo sapiens ribosomal protein L23a pr... 58 4e-08 L13799-1|AAA35681.1| 147|Homo sapiens protein ( Homo sapiens (c... 58 4e-08 BC058041-1|AAH58041.1| 156|Homo sapiens ribosomal protein L23a ... 58 4e-08 BC014459-1|AAH14459.1| 156|Homo sapiens ribosomal protein L23a ... 58 4e-08 AF001689-1|AAC51934.1| 156|Homo sapiens ribosomal protein L23A ... 58 4e-08 BC098172-1|AAH98172.1| 130|Homo sapiens RPL23AP13 protein protein. 54 6e-07 BC096740-1|AAH96740.1| 130|Homo sapiens RPL23AP13 protein protein. 54 6e-07 BC096706-1|AAH96706.1| 130|Homo sapiens RPL23AP13 protein protein. 54 6e-07 AC092839-2|AAX93105.1| 130|Homo sapiens unknown protein. 54 6e-07 AE006463-8|AAK61228.1| 156|Homo sapiens 60S ribosomal protein L... 48 5e-05 BX005428-8|CAM26185.1| 123|Homo sapiens major histocompatibilit... 36 0.17 BX005428-6|CAM26183.1| 442|Homo sapiens major histocompatibilit... 36 0.17 BC009260-1|AAH09260.2| 460|Homo sapiens HLA-F protein protein. 36 0.17 AL844851-8|CAM25789.1| 123|Homo sapiens major histocompatibilit... 36 0.17 AL844851-6|CAI18575.2| 442|Homo sapiens major histocompatibilit... 36 0.17 AL669813-9|CAM24949.1| 123|Homo sapiens major histocompatibilit... 36 0.17 AL669813-7|CAI17628.1| 442|Homo sapiens major histocompatibilit... 36 0.17 AL645939-8|CAM25440.1| 123|Homo sapiens major histocompatibilit... 36 0.17 AL645939-6|CAI18086.2| 442|Homo sapiens major histocompatibilit... 36 0.17 AL022723-13|CAI20359.1| 442|Homo sapiens major histocompatibili... 36 0.17 BC065556-1|AAH65556.1| 121|Homo sapiens similar to RPL23AP7 pro... 33 0.93 BC105600-1|AAI05601.1| 121|Homo sapiens MGC70863 protein protein. 32 2.8 >U43701-1|AAB03210.1| 156|Homo sapiens ribosomal protein L23a protein. Length = 156 Score = 58.0 bits (134), Expect = 4e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG H + +KIR S FRRPKT R PKYPRKS Sbjct: 20 KALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKS 64 >U37230-1|AAB17510.1| 156|Homo sapiens ribosomal protein L23a protein. Length = 156 Score = 58.0 bits (134), Expect = 4e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG H + +KIR S FRRPKT R PKYPRKS Sbjct: 20 KALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKS 64 >U02032-1|AAA03341.1| 156|Homo sapiens ribosomal protein L23a protein. Length = 156 Score = 58.0 bits (134), Expect = 4e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG H + +KIR S FRRPKT R PKYPRKS Sbjct: 20 KALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKS 64 >L13799-1|AAA35681.1| 147|Homo sapiens protein ( Homo sapiens (clone 01) liver expressed protein mRNA, 3'end. ). Length = 147 Score = 58.0 bits (134), Expect = 4e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG H + +KIR S FRRPKT R PKYPRKS Sbjct: 11 KALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKS 55 >BC058041-1|AAH58041.1| 156|Homo sapiens ribosomal protein L23a protein. Length = 156 Score = 58.0 bits (134), Expect = 4e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG H + +KIR S FRRPKT R PKYPRKS Sbjct: 20 KALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKS 64 >BC014459-1|AAH14459.1| 156|Homo sapiens ribosomal protein L23a protein. Length = 156 Score = 58.0 bits (134), Expect = 4e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG H + +KIR S FRRPKT R PKYPRKS Sbjct: 20 KALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKS 64 >AF001689-1|AAC51934.1| 156|Homo sapiens ribosomal protein L23A protein. Length = 156 Score = 58.0 bits (134), Expect = 4e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG H + +KIR S FRRPKT R PKYPRKS Sbjct: 20 KALKAKKAVLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKS 64 >BC098172-1|AAH98172.1| 130|Homo sapiens RPL23AP13 protein protein. Length = 130 Score = 54.0 bits (124), Expect = 6e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG HG + +KIR S F+RPKT R P+YPRK+ Sbjct: 20 KALKAKKVVLKGVHGHKKKKIRMSPTFQRPKTLRLWRPPRYPRKT 64 >BC096740-1|AAH96740.1| 130|Homo sapiens RPL23AP13 protein protein. Length = 130 Score = 54.0 bits (124), Expect = 6e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG HG + +KIR S F+RPKT R P+YPRK+ Sbjct: 20 KALKAKKVVLKGVHGHKKKKIRMSPTFQRPKTLRLWRPPRYPRKT 64 >BC096706-1|AAH96706.1| 130|Homo sapiens RPL23AP13 protein protein. Length = 130 Score = 54.0 bits (124), Expect = 6e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG HG + +KIR S F+RPKT R P+YPRK+ Sbjct: 20 KALKAKKVVLKGVHGHKKKKIRMSPTFQRPKTLRLWRPPRYPRKT 64 >AC092839-2|AAX93105.1| 130|Homo sapiens unknown protein. Length = 130 Score = 54.0 bits (124), Expect = 6e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ V+KG HG + +KIR S F+RPKT R P+YPRK+ Sbjct: 20 KALKAKKVVLKGVHGHKKKKIRMSPTFQRPKTLRLWRPPRYPRKT 64 >AE006463-8|AAK61228.1| 156|Homo sapiens 60S ribosomal protein L23A like protein. Length = 156 Score = 47.6 bits (108), Expect = 5e-05 Identities = 22/45 (48%), Positives = 29/45 (64%) Frame = +1 Query: 670 KALKAQRKVVKGEHGKRVRKIRXSVHFRRPKTFEPPRHPKYPRKS 804 KALKA++ +KG H +K R S+ F+RPKT R P+YP KS Sbjct: 20 KALKAKKAALKGVHSHIKKKTRTSLTFQRPKTLRRRRRPEYPWKS 64 >BX005428-8|CAM26185.1| 123|Homo sapiens major histocompatibility complex class I F protein. Length = 123 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 50 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 97 >BX005428-6|CAM26183.1| 442|Homo sapiens major histocompatibility complex class I F protein. Length = 442 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 369 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 416 >BC009260-1|AAH09260.2| 460|Homo sapiens HLA-F protein protein. Length = 460 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 387 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 434 >AL844851-8|CAM25789.1| 123|Homo sapiens major histocompatibility complex, class I, F protein. Length = 123 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 50 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 97 >AL844851-6|CAI18575.2| 442|Homo sapiens major histocompatibility complex, class I, F protein. Length = 442 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 369 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 416 >AL669813-9|CAM24949.1| 123|Homo sapiens major histocompatibility complex, class I, F protein. Length = 123 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 50 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 97 >AL669813-7|CAI17628.1| 442|Homo sapiens major histocompatibility complex, class I, F protein. Length = 442 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 369 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 416 >AL645939-8|CAM25440.1| 123|Homo sapiens major histocompatibility complex, class I, F protein. Length = 123 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 50 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 97 >AL645939-6|CAI18086.2| 442|Homo sapiens major histocompatibility complex, class I, F protein. Length = 442 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 369 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 416 >AL022723-13|CAI20359.1| 442|Homo sapiens major histocompatibility complex, class I, F protein. Length = 442 Score = 35.9 bits (79), Expect = 0.17 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = -2 Query: 800 FLGYLGCLGGSNVLGLRKCTXLRIFRTLFPCSPFTTFL*ALSALVTGF 657 F GYLGCL +VLG RK + I L+ + F T AL +L GF Sbjct: 369 FQGYLGCLRSHSVLGRRKVGDMWILFFLWLWTSFNTAFLALQSLRFGF 416 >BC065556-1|AAH65556.1| 121|Homo sapiens similar to RPL23AP7 protein protein. Length = 121 Score = 33.5 bits (73), Expect = 0.93 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 Query: 739 SVHFRRPKTFEPPRHPKYPRKS 804 S+ FRRPKT R P+YPRKS Sbjct: 2 SLTFRRPKTLRLRRQPRYPRKS 23 >BC105600-1|AAI05601.1| 121|Homo sapiens MGC70863 protein protein. Length = 121 Score = 31.9 bits (69), Expect = 2.8 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +1 Query: 739 SVHFRRPKTFEPPRHPKYPRKS 804 S+ FRRPKT R P+YP+KS Sbjct: 2 SLTFRRPKTLRLRRQPRYPQKS 23 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,879,787 Number of Sequences: 237096 Number of extensions: 901324 Number of successful extensions: 2315 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2311 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10092110758 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -