BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_I08 (911 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8MXZ7 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: ... 96 1e-18 UniRef50_P77947 Cluster: Malate synthase; n=9; Bacteria|Rep: Mal... 36 1.4 >UniRef50_Q8MXZ7 Cluster: Cuticle protein; n=1; Bombyx mori|Rep: Cuticle protein - Bombyx mori (Silk moth) Length = 407 Score = 95.9 bits (228), Expect = 1e-18 Identities = 61/224 (27%), Positives = 61/224 (27%) Frame = +1 Query: 136 SFFHGLGYDSNYGSTFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGYTSP 315 SFFHGLGYDSNYGSTF GYTSP Sbjct: 29 SFFHGLGYDSNYGSTFGYGSGYQNLGGLGYSGYSSPSVYSSPSSYSYSTPAVSSYGYTSP 88 Query: 316 AVSYANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTP 495 AVSYAN TP Sbjct: 89 AVSYANAGYRYASPAYSYAAPAFSAASYAAPVYSAASYAAPAYSAASYAPAVSSYGYSTP 148 Query: 496 QVRYSSAPAVSYSSFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 675 QVRYSSAPAVSYSSFT Sbjct: 149 QVRYSSAPAVSYSSFTSVPSVKYAAAPAVSYSAAPAVSYSAAPAVSYSAAPALSYSAVAP 208 Query: 676 XXXXXXXXXXXXXXXXXXXXXXXXXXVKYSAXPAVSYTXPISYT 807 VKYSA PAVSYT PISYT Sbjct: 209 AVKYSAAPAVSYSAAPALSYSAVAPAVKYSAAPAVSYTAPISYT 252 >UniRef50_P77947 Cluster: Malate synthase; n=9; Bacteria|Rep: Malate synthase - Streptomyces arenae Length = 543 Score = 35.9 bits (79), Expect = 1.4 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = -2 Query: 145 GRSYACHVRPCLLSWRRRQWPRGHKIKTKDLISVDLTVGCRR 20 G++YA +RP L SWR WPRG + + L+ D + G RR Sbjct: 152 GKTYA--LRP-LKSWRPSSWPRGWHLNERHLVDPDGSFGARR 190 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 349,471,810 Number of Sequences: 1657284 Number of extensions: 3347784 Number of successful extensions: 11063 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11019 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 83211448033 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -