BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_I07 (799 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 3.6 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 25 3.6 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 24 6.3 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 8.3 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.6 bits (51), Expect = 3.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 766 APIHFPSCLARKQSLGQL 713 AP +FP+C K LGQL Sbjct: 963 APANFPTCYDFKPKLGQL 980 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 24.6 bits (51), Expect = 3.6 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 249 KKTKDLSQADELCIKSQEHLNETLANTLHINNINSN 356 K T++ + A+ L + + H L T++IN+IN N Sbjct: 1471 KATEECTNAN-LSLDTTSHSGNLLKATVYINDINDN 1505 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.8 bits (49), Expect = 6.3 Identities = 12/50 (24%), Positives = 23/50 (46%) Frame = +3 Query: 381 SNGSSEVLSEKTDGQGETVNKVTNDVNSVQHNDTSNNFEGKKTTMPSINR 530 +NG E T G + + + +NS+Q ND+ + + + S N+ Sbjct: 243 TNGVGEESGCPTIPAGPSKSATNHSINSIQSNDSGSRRHSAEILVSSNNK 292 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.4 bits (48), Expect = 8.3 Identities = 6/25 (24%), Positives = 18/25 (72%) Frame = +3 Query: 213 IKCSQMNTKNKSKKTKDLSQADELC 287 ++C++ + +N +++T+ + Q +E C Sbjct: 1046 VRCTRNDLRNVARRTQTVRQREEQC 1070 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 760,591 Number of Sequences: 2352 Number of extensions: 15362 Number of successful extensions: 66 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -