BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_H24 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) 338 3e-93 SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_41168| Best HMM Match : Borrelia_orfA (HMM E-Value=0.77) 33 0.21 SB_25666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_34026| Best HMM Match : PLDc (HMM E-Value=0.063) 29 3.4 SB_44438| Best HMM Match : Phosphorylase (HMM E-Value=1e-22) 29 4.5 SB_24053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_25478| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_44630| Best HMM Match : HECT (HMM E-Value=0) 28 6.0 SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_30413| Best HMM Match : WSC (HMM E-Value=2.4) 28 7.9 SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) 28 7.9 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 28 7.9 >SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 338 bits (830), Expect = 3e-93 Identities = 160/186 (86%), Positives = 172/186 (92%) Frame = +2 Query: 83 VFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKD 262 V SKTY TPRRPFEK RL+QELKIIGEYGLRNKREVWRVK TLA+IRKAARELLTLEEKD Sbjct: 5 VCSKTYTTPRRPFEKERLNQELKIIGEYGLRNKREVWRVKLTLAKIRKAARELLTLEEKD 64 Query: 263 PKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHAR 442 P+RLFEGNALLRRLVRIGVLDE + KLDYVLGL+IEDFLERRLQTQVFK GLAKSIHHAR Sbjct: 65 PRRLFEGNALLRRLVRIGVLDESRKKLDYVLGLRIEDFLERRLQTQVFKLGLAKSIHHAR 124 Query: 443 ILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKNLRKGQGGGAA 622 +LIRQRHIRVRKQ+VN+PSF+VRLDS KHIDFSL SP+GGGRPGRVKRKN++KGQGG Sbjct: 125 VLIRQRHIRVRKQLVNVPSFVVRLDSQKHIDFSLNSPYGGGRPGRVKRKNMKKGQGGSGG 184 Query: 623 NDEXED 640 DE ED Sbjct: 185 EDEDED 190 >SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 52.8 bits (121), Expect = 2e-07 Identities = 30/123 (24%), Positives = 61/123 (49%) Frame = +2 Query: 140 QELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPKRLFEGNALLRRLVRIGV 319 +E+K++ +Y ++ + + + I+ A ++ L+ KDP R+ +L +L +G+ Sbjct: 28 REVKVLRKYHIQKREDYTKYNKLSGLIKSLANKIKDLDPKDPYRVEATEQILEKLHNMGL 87 Query: 320 LDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVVNIPS 499 + K+ L + F RRL + +A+ + A I Q H+RV +V+ P+ Sbjct: 88 ISTKK-NLGQCNKVNASSFCRRRLPVVMVNLKMAQVVKDAVKYIEQGHVRVGPEVIMDPA 146 Query: 500 FIV 508 F+V Sbjct: 147 FLV 149 >SB_41168| Best HMM Match : Borrelia_orfA (HMM E-Value=0.77) Length = 738 Score = 33.1 bits (72), Expect = 0.21 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 5/134 (3%) Frame = +2 Query: 215 RIRKAARELLTLEEKDPKRLFEGNALLRRLVRI-GVLDEKQMKLDYVLGLKIEDFLERRL 391 R R+ RE L +D +R +RRL +I L +++++ +L +I L +R+ Sbjct: 246 RKRRRQRERLLRRRRDRQRRLRQRRRMRRLRKIIDNLRKREIRRKVILRRRINR-LNKRM 304 Query: 392 QTQVF----KAGLAKSIHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFG 559 + + K G A+ ++ R+ I +R I + ++ RLD + LK+ Sbjct: 305 RIYINRMRRKHGKARRQYNIRVRILRRQITILRKNKTAKRLRQRLDKVMNHVRRLKNRLA 364 Query: 560 GGRPGRVKRKNLRK 601 R R++RK L + Sbjct: 365 RQRRERLRRKRLNR 378 >SB_25666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.28 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = +2 Query: 110 RRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPK 268 +RP K L Q+ +G+YG KR+ V AARE+L +E PK Sbjct: 57 KRPLGKELLSQQFSDVGKYGRIYKRKFPTVNIVDIADPSAAREVLGIETLGPK 109 >SB_34026| Best HMM Match : PLDc (HMM E-Value=0.063) Length = 499 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/73 (27%), Positives = 36/73 (49%) Frame = -3 Query: 374 SPQSSDQAHNRVSSVFHPVLQYEPDDVEGHYLRTISWGPSPRG*GAHEQPYGYERACI*R 195 SP+ +D H VSSV LQ DD H L+ ++ PS +++ + + + Sbjct: 219 SPEVADFFHELVSSVSDISLQLHKDDTT-HMLKDFAFHPSE----SNKTEFITKATERLK 273 Query: 194 AILHACCGDRTLR 156 ++H+C G + +R Sbjct: 274 TLVHSCSGKKAIR 286 >SB_44438| Best HMM Match : Phosphorylase (HMM E-Value=1e-22) Length = 398 Score = 28.7 bits (61), Expect = 4.5 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 7/76 (9%) Frame = +2 Query: 218 IRKAARELLTLEEKDPKRL-------FEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDF 376 + K R T EKDPKR+ + G AL ++ +G+ E + Y LGL +E+ Sbjct: 100 VGKWIRTQQTYYEKDPKRVYYLSLEYYMGRALSNTMINLGIQGECD-EAAYQLGLDMEEL 158 Query: 377 LERRLQTQVFKAGLAK 424 E + GL + Sbjct: 159 EEMEEDAGLGNGGLGR 174 >SB_24053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2557 Score = 28.7 bits (61), Expect = 4.5 Identities = 33/133 (24%), Positives = 60/133 (45%), Gaps = 11/133 (8%) Frame = +2 Query: 170 LRNKREVWRVKYTLARIRKAARELLTLE--EKDPKR--LFEGNA--LLRRLVRIGVL--D 325 L N E W + AR+R+ +L+ L+ +KD KR + E A L+ R + D Sbjct: 1180 LTNTAEAWTQEQREARLRELKDKLVALDPADKDQKRSVMLEAAAIKLVSRKAHLAKSRED 1239 Query: 326 EKQMKLDYVLGLKIEDF-LERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQ--VVNIP 496 ++ D V+ I D E+ +++ A + + I +++ HI R Q + N+ Sbjct: 1240 GSEVPRDEVMISLIADLQQEQDKESEGVLASMQEKDKDGLIALQKEHIAARAQDTLANVR 1299 Query: 497 SFIVRLDSGKHID 535 + + R + G D Sbjct: 1300 AVLTRGEEGVAAD 1312 >SB_25478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.3 bits (60), Expect = 6.0 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +2 Query: 224 KAARELLTLEEKDPKRLFEGNALLRRLVRIGVLDEKQMKL 343 ++A ELL EK+ KRL E NA L R V++ +++KL Sbjct: 24 RSAAELLDKSEKERKRLSEKNAQLTINERDLVMELERLKL 63 >SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 536 FSLKSPFGGGRPGRVKRKNLRKGQGGGAA 622 F L PF G PGR+ ++N+ + + GG A Sbjct: 1096 FELLKPFIFGYPGRLGQRNVARVRAGGGA 1124 >SB_44630| Best HMM Match : HECT (HMM E-Value=0) Length = 1003 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = -2 Query: 201 LTRHTSRLLRRPYSPMIFNSWSRRAFSKGRRGVTYVFENTDGTLLFTILASSHALLADKN 22 LTRH+S+ R P I S S RR + N+ T+ AS+ A L+D N Sbjct: 40 LTRHSSQPKLRRDEPSITGSLSNLTLDNSRRAASLAQLNSLKATGKTLSASNLAALSDTN 99 >SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1155 Score = 28.3 bits (60), Expect = 6.0 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 1/84 (1%) Frame = +2 Query: 344 DYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVVNI-PSFIVRLDS 520 D + G++ D+ L K +A L QR + V K VV F+++ + Sbjct: 128 DTLRGVQKHDYARLNLDAPALKNPIALPFMRRHQLTPQRIMGVVKTVVQSNEQFVLQGNF 187 Query: 521 GKHIDFSLKSPFGGGRPGRVKRKN 592 H+ P+GGG+ G+ K+ + Sbjct: 188 HLHV-VRTHMPYGGGKRGKSKKNS 210 >SB_30413| Best HMM Match : WSC (HMM E-Value=2.4) Length = 259 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 491 CSQLACGHEYAFAGSKFWHDGWTSP 417 C++LA Y++ G +FW + W+ P Sbjct: 72 CARLAEQKNYSYFGVQFWGECWSGP 96 >SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) Length = 454 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 125 KARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPK 268 K L Q+ +G+YG KR+ V AARE+L +E PK Sbjct: 2 KELLSQQFSDVGKYGRIYKRKFPTVNIVDIADPSAAREVLGIETLGPK 49 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 302 LVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARIL 448 L++I D+K M+ +Y+LGL +E +R +++ + K H R L Sbjct: 806 LLQILTQDDKNMEAEYLLGLILERQGKRLEAMKLYMDVIRKDTSHVRAL 854 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,914,657 Number of Sequences: 59808 Number of extensions: 447233 Number of successful extensions: 1197 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1194 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -