BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_H23 (657 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 31 0.008 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 21 6.7 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 31.1 bits (67), Expect = 0.008 Identities = 31/146 (21%), Positives = 56/146 (38%), Gaps = 7/146 (4%) Frame = +2 Query: 239 QNSSTIAPVTEPTQELVNYEALKYIVGRPFNLNCTLAVPLDSFEIVWKKNSVPLGEVAGL 418 ++ T+ VT P + + + GRP C +FE P+ ++ L Sbjct: 316 ESVETVLTVTAPLKAKIEPQVQTIDFGRPATFTC-------NFE------GNPIKTISWL 362 Query: 419 KERYELQNKGLTFQIKGRSNEDDYGNYTCGLKNQTGHIKAWM---VTGNVHAKMTKDA-- 583 K+ + + + +I+ ED G Y C ++N +A + G + A Sbjct: 363 KDGHPIDHNEAVLRIESVRKEDK-GMYQCFIRNDQESAEATAELKLGGRFEPPQIRHAFN 421 Query: 584 --NVVEGQNIXITCKLIGKPYSEVTW 655 V G ++ + C G P E+TW Sbjct: 422 EETVQPGNSVFLKCIASGNPTPEITW 447 Score = 25.8 bits (54), Expect = 0.31 Identities = 15/61 (24%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +2 Query: 482 DDYGNYTCGLKNQTG---HIKAWMVTGNVHAKMTKDANVVEGQNIXITCKLIGKPYSEVT 652 +D G Y C ++ G H V G + + +V G + + C G P V Sbjct: 484 NDGGLYRCVASSKVGSADHSARINVYGLPFVRSMEKQAIVAGGTLIVHCPFAGHPVDSVV 543 Query: 653 W 655 W Sbjct: 544 W 544 Score = 24.2 bits (50), Expect = 0.96 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 5/60 (8%) Frame = +2 Query: 491 GNYTCGLKNQTGHIKAWMVTG--NVHAKMT---KDANVVEGQNIXITCKLIGKPYSEVTW 655 GNYTC L + + + + + NV + D +G + + CK G P VTW Sbjct: 674 GNYTC-LASNSASVTTYTTSLFINVPPRWILEPTDKAFAQGSDAAVECKADGFPRPVVTW 732 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 21.4 bits (43), Expect = 6.7 Identities = 5/10 (50%), Positives = 9/10 (90%) Frame = +3 Query: 261 RSPSPPKNWS 290 ++P PP+NW+ Sbjct: 17 KAPQPPENWT 26 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,601 Number of Sequences: 336 Number of extensions: 2843 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -