BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_H20 (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 3.7 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 23 3.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.5 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = +2 Query: 164 KPLVVVPTPSEKTVVLPLPKTSTVETLHGSLPIQGLK 274 K + P P +K + K + + G P+QG++ Sbjct: 3 KSTKIFPVPGDKNLHKSYSKMLILAQIFGFFPVQGVR 39 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = +2 Query: 164 KPLVVVPTPSEKTVVLPLPKTSTVETLHGSLPIQGLK 274 K + P P +K + K + + G P+QG++ Sbjct: 3 KSTKIFPVPGDKNLHKSYSKMLILAQIFGFFPVQGVR 39 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 596 PLFIRHRTADEISTEKAVPVDTLRDPQHDDQ 688 P F R R+ + + V+T+ DP+ DD+ Sbjct: 146 PSFARGRSLYDSRGRHSEIVETVYDPREDDR 176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,326 Number of Sequences: 336 Number of extensions: 4144 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -