BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_H02 (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.50 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 6.2 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.4 bits (53), Expect = 0.50 Identities = 7/26 (26%), Positives = 17/26 (65%) Frame = +2 Query: 41 IICLFYL*LVKLEYCCCVILKAINIL 118 ++C++Y + L +CC I+ +++L Sbjct: 255 LVCIYYFYYMHLLFCCAFIIFTMHLL 280 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -2 Query: 184 LLSEGSLNNDFNNMIYVILFEV*NIYSFQYDATTVFKFHK 65 + S+ N+ + I ++ F+ ++Y F Y V F+K Sbjct: 51 IYSKSFHRNEIHIKIVLMFFKEASLYCFNYYVIVVTTFYK 90 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,976 Number of Sequences: 336 Number of extensions: 3855 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -