BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_G19 (466 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.4 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 5.6 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 7.4 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 7.4 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 7.4 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 21 7.4 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 7.4 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 7.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 1.4 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 103 PTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTV 231 P K + ++ + S P TT +T T STT T TV Sbjct: 1157 PGHKPSTSSWQKPTKPSYRPPSTTNHWQTKTTTSTTTRPTTTV 1199 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 5.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 144 PYIVNPPKDYNPNGNGYE 197 P+IV P++ NP+ Y+ Sbjct: 192 PFIVRVPEEDNPHAKLYD 209 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 20.6 bits (41), Expect = 7.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 Query: 95 GYGQRSRKRLRTY*QPPVH 151 GYG +L ++ PP+H Sbjct: 80 GYGNYYHPQLHSHHGPPIH 98 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 20.6 bits (41), Expect = 7.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 Query: 95 GYGQRSRKRLRTY*QPPVH 151 GYG +L ++ PP+H Sbjct: 80 GYGNYYHPQLHSHHGPPIH 98 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 20.6 bits (41), Expect = 7.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 Query: 95 GYGQRSRKRLRTY*QPPVH 151 GYG +L ++ PP+H Sbjct: 80 GYGNYYHPQLHSHHGPPIH 98 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 20.6 bits (41), Expect = 7.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 Query: 95 GYGQRSRKRLRTY*QPPVH 151 GYG +L ++ PP+H Sbjct: 80 GYGNYYHPQLHSHHGPPIH 98 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +1 Query: 16 NFNIFACDNS*SYKNEILHDFRPRLC 93 ++NIFACD + + R +C Sbjct: 49 HYNIFACDGCAGFFKRSIRRNRQYVC 74 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +1 Query: 16 NFNIFACDNS*SYKNEILHDFRPRLC 93 ++NIFACD + + R +C Sbjct: 49 HYNIFACDGCAGFFKRSIRRNRQYVC 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,432 Number of Sequences: 336 Number of extensions: 1946 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10721526 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -