BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_G13 (797 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74043-5|CAA98544.1| 588|Caenorhabditis elegans Hypothetical pr... 29 3.9 AF039050-11|AAC47941.1| 333|Caenorhabditis elegans Seven tm rec... 28 8.9 >Z74043-5|CAA98544.1| 588|Caenorhabditis elegans Hypothetical protein T19B10.9 protein. Length = 588 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 Query: 619 FHLRMLSYKSTNSITIFFCLMTSSYIVY 536 FHL M Y+ +N IT+ CL T Y Y Sbjct: 510 FHLTMDIYRRSNDITLQICLDTPFYCPY 537 >AF039050-11|AAC47941.1| 333|Caenorhabditis elegans Seven tm receptor protein 83 protein. Length = 333 Score = 27.9 bits (59), Expect = 8.9 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 Query: 393 LLIVNEYFVRRYTYYLLCTIYAHSK*RNILILVCF 497 +L++ YF+ YTY+L T + + + +++V F Sbjct: 60 ILVLPSYFIYEYTYFLFTTQFTQYQNMSQILIVTF 94 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,358,394 Number of Sequences: 27780 Number of extensions: 219181 Number of successful extensions: 386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -