Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P02_F_G08
         (773 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    24   4.5  
AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding pr...    23   7.9  

>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative
           cytoskeletal structural protein protein.
          Length = 1645

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%)
 Frame = +1

Query: 667 PFCIYFG*RSLFIFKWTSR*F-KCSFLVVIKIMRDC 771
           PFC+ F    LF+ + T + F   SFL+   +   C
Sbjct: 8   PFCLLFNLYFLFVVRGTGKPFLPTSFLIYCFVSPSC 43


>AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding
           protein AgamOBP45 protein.
          Length = 356

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 9/14 (64%), Positives = 12/14 (85%), Gaps = 1/14 (7%)
 Frame = +3

Query: 495 LKCFFLRTQI-HID 533
           L+CFFLRT + H+D
Sbjct: 199 LRCFFLRTGVFHVD 212


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 712,019
Number of Sequences: 2352
Number of extensions: 13570
Number of successful extensions: 73
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 73
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 73
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 80665782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)