BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F24 (787 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 268 1e-73 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 26 1.5 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 25 2.0 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 25 2.0 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 25 2.7 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 4.6 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 24 4.6 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 4.6 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 24 6.1 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 6.1 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 268 bits (658), Expect = 1e-73 Identities = 123/199 (61%), Positives = 149/199 (74%) Frame = +3 Query: 189 NPLFEKRPKNFAIGQGIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLD 368 NPLFEKR KN+ IGQ +QP RDLSRFV+WPKYIRIQR +A+LQ+RLK+PPPINQFTQTLD Sbjct: 35 NPLFEKRVKNYGIGQNVQPKRDLSRFVKWPKYIRIQRHRAILQKRLKIPPPINQFTQTLD 94 Query: 369 KTTAKGLFKILEKYRPETXXXXXXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNTVTKLVE 548 K TA+ + K +KYRPE R N +R G N+V K+VE Sbjct: 95 KPTAQQVMKCWKKYRPENPIARVQRLKAKAEAKAAGKEEPPSKRANQLRQGINSVVKMVE 154 Query: 549 KKKAQLVVIAHDVDPIELVLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCLXLTNVE 728 +KKAQLV+IAHDVDPIELV++LPALCRKMGVPYCI+KGK+RLG LV+RKTCTC+ LT E Sbjct: 155 QKKAQLVIIAHDVDPIELVVYLPALCRKMGVPYCIIKGKARLGTLVYRKTCTCVALTQFE 214 Query: 729 SGDRASFSKVVEAIXTNFN 785 + D+ + +K+VE I TNFN Sbjct: 215 NADKPNLAKLVETIKTNFN 233 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.5 Identities = 20/59 (33%), Positives = 25/59 (42%) Frame = +2 Query: 506 HHPIRHKHSHQAGREEEGAACGHRS*C*SH*AGSLPASVMP*NGRTILHCQGQVPPRCT 682 HH + H H H G EG G + S AG L A V P I + + Q P + T Sbjct: 1315 HHHLHHGHHHHHG--GEGVPMGPANAAPSSPAGVLVAKVPPVAVEDIENSKQQPPVQQT 1371 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 25.4 bits (53), Expect = 2.0 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 708 SMCMSCGVQVHRGGTC 661 ++C+ CG + H+ GTC Sbjct: 572 NVCIRCGQEGHKAGTC 587 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 25.4 bits (53), Expect = 2.0 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -2 Query: 348 G*SEGALSDDAEVQPSGAGCGYTWAILQIWTSPELAECPD-QWQSSLASSR 199 G +G + DA V+P GCG + L A+ + W +L SSR Sbjct: 174 GLGDGPTARDATVRPEERGCGLSTKQLSKIAGGRPADSNEWPWMVALVSSR 224 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 25.0 bits (52), Expect = 2.7 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +3 Query: 273 WPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPE 419 W ++ + + RLKV + T+T+++ A+ + L ++RPE Sbjct: 216 WKLFLMTSYRSVARKLRLKVCS--RELTETVERVAAEAINSKLHEHRPE 262 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.2 bits (50), Expect = 4.6 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -3 Query: 428 CFSLRPVFLQNLEKALSCSLVQCLGKLVDRRGH 330 CF + V ++ + S + + L + V RRGH Sbjct: 1454 CFVTKAVHIELVSNLTSSAFLAALRRFVARRGH 1486 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 24.2 bits (50), Expect = 4.6 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -2 Query: 285 YTWAI--LQIWTSPELAECPDQWQSSLASSRR 196 YT+A L++W S + EC + ++ S RR Sbjct: 263 YTYARVGLELWGSKSIGECTQRQLDNIKSKRR 294 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.2 bits (50), Expect = 4.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 708 SMCMSCGVQVHRGGTC 661 S+C+ CG HR +C Sbjct: 311 SLCLHCGAADHRAASC 326 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 467 LSFSSFPQPLFPGCFSLRPVFLQNLEKAL 381 + F F QP+F C+ L + L+N+ + Sbjct: 506 IKFGLFFQPIFSVCWFLEVIALENVHSCV 534 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 6.1 Identities = 10/41 (24%), Positives = 20/41 (48%) Frame = -2 Query: 264 IWTSPELAECPDQWQSSLASSRREDSRSSWAQPF*PPMGRR 142 +WT+ + CP Q Q L +++ + + + PP R+ Sbjct: 419 LWTTV-VRSCPSQRQRQLQQQQQQQQQQQQGERYVPPQLRQ 458 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 760,692 Number of Sequences: 2352 Number of extensions: 15797 Number of successful extensions: 44 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -