BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F22 (769 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0292 - 2200714-2201478,2202691-2203395 33 0.33 01_05_0410 + 21914995-21915168,21915268-21915353,21915446-219156... 31 0.77 05_01_0313 - 2461487-2461861,2461929-2462513,2462819-2464154,246... 29 4.1 02_02_0134 + 7082462-7082627,7084199-7084325,7084404-7084611,708... 29 5.4 04_04_1273 - 32307273-32307569,32307659-32307791,32307874-323081... 28 9.4 04_03_0583 + 17539541-17539978 28 9.4 >11_01_0292 - 2200714-2201478,2202691-2203395 Length = 489 Score = 32.7 bits (71), Expect = 0.33 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -3 Query: 311 SLSEIIPFAVLHVVLFTLHQSRFFV--VIYFVGISFSFDHFTFQIVNVVKDXIA 156 S S IPF ++F L QSRF + V+ FV IS + HF F+ + + IA Sbjct: 279 SFSSFIPFDSR--IVFLLPQSRFPIWSVVLFVSISLALSHFIFEKEAPITENIA 330 >01_05_0410 + 21914995-21915168,21915268-21915353,21915446-21915656, 21915869-21915998,21916740-21916924,21917014-21917145, 21917329-21917433 Length = 340 Score = 31.5 bits (68), Expect = 0.77 Identities = 20/68 (29%), Positives = 35/68 (51%) Frame = -3 Query: 428 LLRANLHWRQLLDVLLIVSETFRDFLIEGVHQIFKRTGESLSEIIPFAVLHVVLFTLHQS 249 LL+ H Q L +L + + ++ EG+ +K G S+ I+P+A LH + T Q Sbjct: 56 LLQTRTHGFQSLGILQSLRKLWQ---YEGIRGFYKGNGASVLRIVPYAALHYM--TYEQY 110 Query: 248 RFFVVIYF 225 R +++ F Sbjct: 111 RCWILNNF 118 >05_01_0313 - 2461487-2461861,2461929-2462513,2462819-2464154, 2464231-2464338,2464421-2464743 Length = 908 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Frame = +3 Query: 441 ECQMWWTITGNFGNILPIDWTKSFSRKMHIPTL--NLSDTKNSLTPDDEIHSSEDEAV-A 611 E W +T N ++ W S+K+ +PT N + L + I SS D AV Sbjct: 656 ETPQGWVLTLNPASLQTFLWRPQDSKKIDLPTAKQNFPRSGKCLLSGNPISSSSDCAVLV 715 Query: 612 SDLDMHALIL 641 DLD A+++ Sbjct: 716 LDLDTPAMLV 725 >02_02_0134 + 7082462-7082627,7084199-7084325,7084404-7084611, 7084864-7084990,7085071-7085255,7085332-7085454, 7085777-7085836,7085980-7086117 Length = 377 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/69 (24%), Positives = 34/69 (49%) Frame = -3 Query: 422 RANLHWRQLLDVLLIVSETFRDFLIEGVHQIFKRTGESLSEIIPFAVLHVVLFTLHQSRF 243 RA H L+ +S T EG+ ++ G S++ I+P+A LH + + + R Sbjct: 72 RAEFHGSGLIGSFRTISRT------EGLLGFYRGNGASVARIVPYAALHYMAY--EEYRR 123 Query: 242 FVVIYFVGI 216 ++++ F + Sbjct: 124 WIILGFPNV 132 >04_04_1273 - 32307273-32307569,32307659-32307791,32307874-32308105, 32308220-32308436,32308594-32308718,32309416-32310757 Length = 781 Score = 27.9 bits (59), Expect = 9.4 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -3 Query: 422 RANLHWRQLLDVLLIVSE 369 RANLHWR+ LD++ +++ Sbjct: 567 RANLHWRRRLDIIQAIAK 584 >04_03_0583 + 17539541-17539978 Length = 145 Score = 27.9 bits (59), Expect = 9.4 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 343 PSMRKSRNVSETMRRTSRSWRQCRFARRRKS*TNAKCG 456 P RK R RR R WR R ARRR TN + G Sbjct: 13 PGRRKGR---PKRRRRQRGWRGRRNARRRGLQTNQRAG 47 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,066,949 Number of Sequences: 37544 Number of extensions: 373553 Number of successful extensions: 1200 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1200 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -