BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F21 (803 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 26 1.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 26 1.6 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.7 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 25.8 bits (54), Expect = 1.6 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 201 PGDDH-GDPAPAQDGEAVAPMAPKNR 127 PG H +PAP +G V P AP+ R Sbjct: 67 PGRSHPAEPAPGGNGPFVRPDAPQGR 92 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = +2 Query: 398 HTCAYTLCYCTCSCPDSI-----NSWTRTLSE 478 H C + C C +CP++ NSW+ + E Sbjct: 781 HCCEFDACDCEMTCPNNCACYHDNSWSTNIVE 812 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.0 bits (52), Expect = 2.7 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 Query: 305 LNRSCCSTCRRIASIPC*HPQQPCDREPRHHHTCAYTLCYCTCSC 439 +N S + S PC HP P RE + A T C C Sbjct: 481 INESLTVDIEMLCSCPCEHPSDPEYRERADECSNAGTYKCGICEC 525 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,444 Number of Sequences: 2352 Number of extensions: 12055 Number of successful extensions: 36 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -