BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F20 (818 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.9 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 3.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.1 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 8.9 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 405 QVAPHLSRLRSAGRGDGHPLPRTLHHRRQAEPQ---ADHHQRP 524 QVAP + A GH L T+ Q +PQ + H Q P Sbjct: 47 QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSP 89 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 405 QVAPHLSRLRSAGRGDGHPLPRTLHHRRQAEPQ---ADHHQRP 524 QVAP + A GH L T+ Q +PQ + H Q P Sbjct: 47 QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSP 89 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 405 QVAPHLSRLRSAGRGDGHPLPRTLHHRRQAEPQ---ADHHQRP 524 QVAP + A GH L T+ Q +PQ + H Q P Sbjct: 47 QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSP 89 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 405 QVAPHLSRLRSAGRGDGHPLPRTLHHRRQAEPQ---ADHHQRP 524 QVAP + A GH L T+ Q +PQ + H Q P Sbjct: 47 QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSP 89 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 405 QVAPHLSRLRSAGRGDGHPLPRTLHHRRQAEPQ---ADHHQRP 524 QVAP + A GH L T+ Q +PQ + H Q P Sbjct: 47 QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSP 89 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 405 QVAPHLSRLRSAGRGDGHPLPRTLHHRRQAEPQ---ADHHQRP 524 QVAP + A GH L T+ Q +PQ + H Q P Sbjct: 47 QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSP 89 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 405 QVAPHLSRLRSAGRGDGHPLPRTLHHRRQAEPQ---ADHHQRP 524 QVAP + A GH L T+ Q +PQ + H Q P Sbjct: 47 QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLASTHLQSP 89 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 210 EQHNIFPLVVRQRNVLE-RSVDDGRGLELGSGFGQMQ 103 +Q + ++ Q ++ RS DD +G GSG G Q Sbjct: 499 QQTQHYTNIISQEQIISWRSSDDAKGGGGGSGSGNNQ 535 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 405 QVAPHLSRLRSAGRGDGHPLPRTLHHRRQAEPQ 503 QVAP + A GH L T+ Q +PQ Sbjct: 47 QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQ 79 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.4 bits (43), Expect = 8.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 94 NLPLHLPKPAPQF 132 +LPLH P P P + Sbjct: 157 SLPLHYPPPPPVY 169 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,103 Number of Sequences: 336 Number of extensions: 2897 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -