BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F17 (498 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0875 - 25584789-25585307,25585424-25585570,25585734-255858... 27 6.3 >06_03_0875 - 25584789-25585307,25585424-25585570,25585734-25585897, 25586015-25586172,25586536-25586904,25586998-25587209, 25587439-25588059,25588561-25588699,25588968-25589044, 25589120-25589800,25590641-25590889 Length = 1111 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = -2 Query: 284 GSKLKVKLQFIIKLSFIL--YSLPF*YLNYM*VHLTFLSQLNESVSIFYNFL 135 G K LQF+++L+F+L + + ++ Y LTF+ L E+ +F + + Sbjct: 113 GMKACHVLQFVLRLAFVLSVWLMIIPFITYWIWRLTFVRSLGEAQRLFLSHI 164 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,918,314 Number of Sequences: 37544 Number of extensions: 119490 Number of successful extensions: 183 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -