BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F17 (498 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038622-1|AAB94152.1| 358|Caenorhabditis elegans Hypothetical ... 27 10.0 >AF038622-1|AAB94152.1| 358|Caenorhabditis elegans Hypothetical protein R07C12.3 protein. Length = 358 Score = 26.6 bits (56), Expect = 10.0 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = -2 Query: 371 SDSMIYNHMMIQSNTECYRH-----LSHRLNAVSGSKLK 270 +D +IY+H + + NT Y H LS+ ++V S LK Sbjct: 76 ADGIIYHHSLQEFNTSVYAHLPNPSLSYDSSSVGSSSLK 114 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,931,260 Number of Sequences: 27780 Number of extensions: 137324 Number of successful extensions: 313 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -