BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F15 (828 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo... 31 0.15 SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3||... 29 0.61 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 29 0.80 SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosac... 28 1.4 SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|S... 28 1.4 SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe... 27 3.2 SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pomb... 27 4.3 SPBC83.18c |||C2 domain protein|Schizosaccharomyces pombe|chr 2|... 27 4.3 SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|... 27 4.3 SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosacchar... 25 9.9 SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 25 9.9 >SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1588 Score = 31.5 bits (68), Expect = 0.15 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 527 CSSCIVRSTPWLPWRLRRKRTPSVWRLRRKRTPSV 631 C C + PW R + TPSVW L + +PSV Sbjct: 1499 CPDCCSKEGKLYPWNTRPRSTPSVW-LSQAYSPSV 1532 >SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 633 Score = 29.5 bits (63), Expect = 0.61 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = -3 Query: 436 SDQDMNGIASPS---RPAEIMPLSQRTQKPRYSP 344 SD ++ G+ P +PA +PLS+R+ P Y+P Sbjct: 30 SDPELIGLLKPDNVDKPANSIPLSKRSTSPSYAP 63 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 29.1 bits (62), Expect = 0.80 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = -1 Query: 660 KHQPIYRLLQTEGVRFLRSLQTEGVRFLRSLQGSQGVLRTMQ 535 ++ PI LL E ++ L+++ T+ + S QGS+ V+ TMQ Sbjct: 267 QYMPILPLL-LERLKSLQNMHTDAAEAISSWQGSKDVMMTMQ 307 >SPAPB17E12.05 |rpl3703|rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 1|||Manual Length = 89 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 665 RSSTSWRRCGRTGLLXXASVCGSCGSXRCHXPX*TRSFSW 784 +S T RRCG+ S C CG + TRS++W Sbjct: 14 KSHTICRRCGKRSFHIQKSTCACCG----YPAAKTRSYNW 49 >SPCC1223.05c |rpl3702|rpl37-2, rpl37|60S ribosomal protein L37|Schizosaccharomyces pombe|chr 3|||Manual Length = 91 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 665 RSSTSWRRCGRTGLLXXASVCGSCGSXRCHXPX*TRSFSW 784 +S T RRCG+ S C CG + TRS++W Sbjct: 14 KSHTICRRCGKRSFHIQKSTCACCG----YPAAKTRSYNW 49 >SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 687 Score = 27.1 bits (57), Expect = 3.2 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +1 Query: 307 IRLKLKAPEFLTEGNIVVFGFVGIAALSPLDARVKLFHSYLGLIPNLSQFTTSE 468 + L + F G V G V +A+ + RVK ++LG P + T SE Sbjct: 564 VELSISKNIFFIGGGKAVHGLVNLASSRNVSDRVKCMVNFLGTEPLVGLKTASE 617 >SPBC336.15 |pic1|SPBC685.01|INCENP-like|Schizosaccharomyces pombe|chr 2|||Manual Length = 1018 Score = 26.6 bits (56), Expect = 4.3 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = -2 Query: 395 SGDNAAIPTNPKT-----TIFPSVKNSGAFNFNLIGLGSIFPDDALSVSPASNHHLI 240 S + IP+ P T + + KNS A + +L + +D S+SPA +H +I Sbjct: 449 SSNKRLIPSTPPTKKPINAVLDAAKNSAAKDLHLAKMKLNNKNDESSLSPAKSHAVI 505 >SPBC83.18c |||C2 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 272 Score = 26.6 bits (56), Expect = 4.3 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = -3 Query: 412 ASPSRPAEIMPLSQRTQKPRYSPPLRIPGLSISTLSGLVLFFLMTLLAFPQPPIITSYIG 233 + PS+P + +P+S +PP R +S+ S L + L +FP P ++ Y Sbjct: 160 SKPSKPRKKVPVSHPLPP---TPPSREEHVSVPRESSLFTYEDDPLPSFPSPYMVDDYYT 216 Query: 232 SD 227 D Sbjct: 217 QD 218 >SPBC2F12.02c |mrpl7||mitochondrial ribosomal protein subunit L7|Schizosaccharomyces pombe|chr 2|||Manual Length = 287 Score = 26.6 bits (56), Expect = 4.3 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 5/64 (7%) Frame = -3 Query: 442 SGSDQDMNGIASPSRPAEIMPLSQRTQKPRYSPPLRIPGLSISTLSG-----LVLFFLMT 278 S + D G S P+E+MPL + + P +PG +++ + L FF+ + Sbjct: 214 SPTSGDQTGNISFGLPSEVMPLFPQIEAVYEMYPHSLPGFNVNITTNSKDTRLARFFVSS 273 Query: 277 LLAF 266 L+ F Sbjct: 274 LIPF 277 >SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 25.4 bits (53), Expect = 9.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 535 LHCTQHPLATLEATEETYPLRLEATEETYPLRLEEPVYG 651 +HCT + AT E + R T++T+P L+ V G Sbjct: 137 VHCTMYIPATKEHPLRIWVPRRSPTKQTWPNYLDNSVAG 175 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 25.4 bits (53), Expect = 9.9 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -3 Query: 361 KPRYSPPLRIPGLSISTLSGLVLFFLMTLLAFPQPPIITSYIGSD 227 K Y+P I GL++ TLS +LM L+ P ++ + G D Sbjct: 50 KVLYAPRTTIEGLNLPTLSSSYYKWLMDLVNIPD-DVVQNCAGLD 93 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,087,837 Number of Sequences: 5004 Number of extensions: 62762 Number of successful extensions: 214 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 406444570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -