BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F11 (585 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14C8.04 |||acetolactate synthase regulatory unit|Schizosacch... 26 3.5 SPAC31G5.04 |||homoisocitrate dehydrogenase|Schizosaccharomyces ... 26 4.7 SPCC794.10 |||UTP-glucose-1-phosphate uridylyltransferase |Schiz... 25 6.2 >SPBC14C8.04 |||acetolactate synthase regulatory unit|Schizosaccharomyces pombe|chr 2|||Manual Length = 289 Score = 26.2 bits (55), Expect = 3.5 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 6 GRLIRYFELNTNTNEDA*IRDSRLRAGSPLLRCSTTKSPRCS 131 GRL F +T+ + I L A SPL RC + PR + Sbjct: 7 GRLANRFVRLKSTSATSPITYKALHANSPLPRCRIIEPPRAT 48 >SPAC31G5.04 |||homoisocitrate dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 362 Score = 25.8 bits (54), Expect = 4.7 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 331 GFQPKTSLGQK*KPQKPVYINNTPSQHKLDNDFV 432 G P +G++ P + N P++HKL DF+ Sbjct: 10 GLIPADGIGKEVVPAARRLMENLPAKHKLKFDFI 43 >SPCC794.10 |||UTP-glucose-1-phosphate uridylyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 499 Score = 25.4 bits (53), Expect = 6.2 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -2 Query: 365 YFWPNEVLGWKPLGPAVKVTV*CLPSGAT*AYCPVTVRAAFSDC 234 YF N +L + A + T+ C+PS A C VT +C Sbjct: 456 YFGRNVILKGNIVIVASENTILCIPSNAVLENCVVTGNCKIMEC 499 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,422,047 Number of Sequences: 5004 Number of extensions: 49242 Number of successful extensions: 141 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -