BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F11 (585 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 50 2e-08 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.9 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 50.0 bits (114), Expect = 2e-08 Identities = 36/102 (35%), Positives = 49/102 (48%), Gaps = 9/102 (8%) Frame = +1 Query: 73 ACVLVALCSGAPQQNPQ--------DVQILRFDSNVEPDG-YSFAYETSDGTSRQEEGKL 225 A V V LC+ A PQ D I V DG Y +ETS+G S QE G+ Sbjct: 1 ALVAVVLCTTATLAAPQRPSGGADKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQP 60 Query: 226 DNPQSENAALTVTGQYAYVAPDGKHYTVTFTAGPNGFQPKTS 351 +E ++ G +Y APDG+ ++T+ A NGFQ + S Sbjct: 61 KQVDNETPVVS-QGSDSYTAPDGQQVSITYVADENGFQVQGS 101 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +3 Query: 456 IIYPCHVQ*QKQFLISRAIWTLSFICTF 539 + YP + ++ L+ +W LSF+ F Sbjct: 171 VSYPQIMSPRRARLLVATVWILSFVICF 198 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,450 Number of Sequences: 438 Number of extensions: 3442 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -