BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F08 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 36 0.026 SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) 30 1.7 SB_22845| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_59064| Best HMM Match : Adeno_E1A (HMM E-Value=9.3) 29 4.0 SB_31308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_27470| Best HMM Match : Baculo_PEP_C (HMM E-Value=2.8) 29 4.0 SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 29 5.3 SB_8748| Best HMM Match : Astacin (HMM E-Value=0) 29 5.3 SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) 28 7.0 SB_48765| Best HMM Match : A1pp (HMM E-Value=3.5e-34) 28 7.0 SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 7.0 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 28 7.0 SB_55995| Best HMM Match : F5_F8_type_C (HMM E-Value=4.9e-15) 28 9.2 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 28 9.2 SB_21466| Best HMM Match : Xlink (HMM E-Value=1.2) 28 9.2 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 28 9.2 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 36.3 bits (80), Expect = 0.026 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = +2 Query: 113 VTRSTLGDWE-KVPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPP-KPESKLA 286 VT +T E K P P PS +P P T + P A P+ + +PP P A Sbjct: 164 VTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPA 223 Query: 287 PLAPYVSPREQTRARVLST 343 PL P++ P ++ ++T Sbjct: 224 PLHPHIPPAPPNPSKAIAT 242 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = +2 Query: 146 VPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAPLAPYVSP 310 +P P P P+P F P P PP P LAP PY+ P Sbjct: 247 MPETPLPPATPNP---FIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPP 298 >SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) Length = 797 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = +2 Query: 149 PFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAPLAPYVSPR 313 P P P+++ P T+ T P S P P + +S PL Y +PR Sbjct: 141 PCTPVPAVLHSPRTSLAVYTSPRVHNSPRTPFLAYTSPREHQSPRTPLPAYFTPR 195 >SB_22845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1422 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 208 GAPPEGRHRVGHETRPRHERHLLPVPERRP 119 G PPEG H+ H P E+H PER P Sbjct: 1061 GTPPEGHHKHRHRGSPASEQH-GDRPERPP 1089 >SB_59064| Best HMM Match : Adeno_E1A (HMM E-Value=9.3) Length = 336 Score = 29.1 bits (62), Expect = 4.0 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 1/76 (1%) Frame = +2 Query: 164 PSLVPDPVTAFGRRTKPGTRASV-LDPVTKQNIPPKPESKLAPLAPYVSPREQTRARVLS 340 PS+ P P+ + R +P + + DPV KQ IPPK K Y+ R++ +S Sbjct: 269 PSVAPVPIIS---RKEPDFQTPLKTDPVFKQPIPPKSSRKTPNPLKYM-----LRSKSVS 320 Query: 341 TVGQRERAFEADPLGT 388 T +++ E P+ T Sbjct: 321 T-PNKQKHIECKPMST 335 >SB_31308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = -2 Query: 208 GAPPEGRHRVGHETRPRHERHLLPVPERRPRHAVGGPVGPTRRVEVTLVYHG 53 G + ++ + RPRH RH+ E RH G P R V + HG Sbjct: 249 GIVSKSETKISNTKRPRH-RHISLCQETITRHGPGTITTPPRHVPDNITRHG 299 >SB_27470| Best HMM Match : Baculo_PEP_C (HMM E-Value=2.8) Length = 627 Score = 29.1 bits (62), Expect = 4.0 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 2/88 (2%) Frame = +2 Query: 155 VPRPSLVPDPVTAFGRRTKPGTRASVLD-PVTKQNIPPKPESKLAPLAPYVSPREQTRAR 331 V RP +P VT + GTR L VT+ + P+ ++L L P V R T R Sbjct: 191 VTRPDTLPRVVTCLDTLPRVGTRLDTLPRVVTRLDTLPRVVTRLDTL-PRVVTRLDTLPR 249 Query: 332 VLSTVGQRERAF-EADPLGTPRDHMDVL 412 V++ + R D L PR +D L Sbjct: 250 VVTRLDTLPRVVTRLDTL--PRTRLDTL 275 >SB_25851| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 683 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/67 (28%), Positives = 29/67 (43%) Frame = +2 Query: 80 TTRRPYRSTYSVTRSTLGDWEKVPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNI 259 TTRRP +ST+ + T + P +P+ P T RRT+ T + + Sbjct: 509 TTRRPRKSTHRPKKPTRRPRKNSPRTRKPTRRPRKNTHKSRRTRKTTPQPTTQYYSTSHD 568 Query: 260 PPKPESK 280 P +SK Sbjct: 569 PMTSQSK 575 >SB_8748| Best HMM Match : Astacin (HMM E-Value=0) Length = 757 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = -3 Query: 447 AACSGRPCAWASSTSMWSRGVPRGSASNARSRCPTVESTRARVCSRGDT*GARGAN 280 A SG P + ++S + G P A + + PT S G T G+ GAN Sbjct: 543 AGTSGAPTSVPPASSAPASGAPPSGAPASGATTPTTGPISGAPASNGPTSGSTGAN 598 >SB_3353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/67 (28%), Positives = 29/67 (43%) Frame = +2 Query: 80 TTRRPYRSTYSVTRSTLGDWEKVPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNI 259 TTRRP +ST+ + T + P +P+ P T RRT+ T + + Sbjct: 146 TTRRPRKSTHRPKKPTRRPRKNSPRTRKPTRRPRKNTHKSRRTRKTTPQPTTQYYSTSHD 205 Query: 260 PPKPESK 280 P +SK Sbjct: 206 PMTSQSK 212 >SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) Length = 509 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +2 Query: 140 EKVPFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAP 289 +++P RP L+P R T P T + P T P KP + P Sbjct: 23 QQIPHHQRPPLLPSQQLPHNRTTTPTTPTTTTPPAT--TTPTKPTNTTPP 70 >SB_48765| Best HMM Match : A1pp (HMM E-Value=3.5e-34) Length = 354 Score = 28.3 bits (60), Expect = 7.0 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 1/84 (1%) Frame = +1 Query: 133 GLGEGAVRAAAESRARPGDGLRAAHQA-GHARLRVGPRHQTKHPAETGVEVGASRALRIS 309 G G G R E+ RPG GL+ A +A+ R TK A+ + +A Sbjct: 202 GRGRGQKRDWNETARRPGQGLQVKPAAESNAQTDRNARPPTKPTADLSQRTQSIQAADTR 261 Query: 310 ARTNARACAFYRWTAGARVRGGPS 381 +R A+ TA +V PS Sbjct: 262 SRAQAKPATGPSPTADKQVADPPS 285 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -2 Query: 232 HGGARARLGAPPEGRHRVGHETRPRHERHLLPVPERRPRHAV 107 HG RARL +GR+R + L V RRP+ + Sbjct: 1785 HGANRARLHIKKQGRYRGAWSAKHNTRYQFLQVTFRRPKKVI 1826 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -2 Query: 232 HGGARARLGAPPEGRHRVGHETRPRHERHLLPVPERRPRHAV 107 H RARL +GR+R R + L V RRP+ + Sbjct: 3594 HAANRARLHIRRQGRYRGAWSARHNNRNQYLQVSFRRPKEVI 3635 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = -2 Query: 232 HGGARARLGAPPEGRHRVGHETRPRHERHLLPVPERRPRHAV 107 H RARL +GR+R R + L + RRP+ V Sbjct: 2390 HAANRARLHIRRQGRYRGAWSARHNNRNQYLQIDFRRPKKVV 2431 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 28.3 bits (60), Expect = 7.0 Identities = 32/101 (31%), Positives = 42/101 (41%), Gaps = 1/101 (0%) Frame = -3 Query: 552 GVYSSERKRHTTTNDSATAQSSQ-YVA*LL**T*RCAACSGRPCAWASSTSMWSRGVPRG 376 G +SS +R ND A + S+ V +L T R S +P + W +G Sbjct: 7 GTFSSRCRR----NDGAINKCSKTLVLTILASTLRKDTFSPKPDLATGLPTSWPQGDAAT 62 Query: 375 SASNARSRCPTVESTRARVCSRGDT*GARGANFDSGFGGMF 253 + R R V+ TRA V RG G G F G GG F Sbjct: 63 GRGSTRDR-RRVKKTRASVGGRGGGFGG-GGGFGGGGGGGF 101 >SB_55995| Best HMM Match : F5_F8_type_C (HMM E-Value=4.9e-15) Length = 335 Score = 27.9 bits (59), Expect = 9.2 Identities = 26/69 (37%), Positives = 30/69 (43%), Gaps = 4/69 (5%) Frame = +2 Query: 164 PSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESK---LAPLAPYVSPREQTRA-R 331 P L A RRT P TRA VL + + N K LA +A V + T A R Sbjct: 88 PVLAKMAELALTRRTTPATRALVLVGIRELNAKIKSNRATPVLARMAELVLTKRTTPATR 147 Query: 332 VLSTVGQRE 358 L VG RE Sbjct: 148 ALVLVGIRE 156 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -2 Query: 202 PPEGRHRVGHETRPRHERHLLPVPERRPRHAVGGPVGPTR 83 PP + R G PRH++ P+ E RP G P GP R Sbjct: 472 PPYDQGRPGMPPGPRHDQSRPPLDEGRPPLDPGRP-GPGR 510 >SB_21466| Best HMM Match : Xlink (HMM E-Value=1.2) Length = 347 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -2 Query: 250 FGDGVQHGGARARLGAPPEGRHRVGHETRPRHERHLLPVPERRPRHAVGGPV 95 F V G A L P EG+ H++ HE LLP+ ER + G P+ Sbjct: 193 FQSVVAPNGLIANLFGPIEGKR---HDSAMLHESGLLPLLERHAINTAGQPL 241 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -1 Query: 593 VARSGRGPPPRSAAASTLASESDTRQRTTLPPRSPLST 480 V+++ GP A +T+AS+S TTL P+S +++ Sbjct: 1450 VSQTTAGPETTLAQETTMASKSTVEPGTTLAPKSTVAS 1487 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -2 Query: 202 PPEGRHRVGHETRPRHERHLLPVPERRPRHAVGGPVGPTR 83 PP + R G PRH++ P+ E RP G P GP R Sbjct: 238 PPYDQGRPGMPPGPRHDQSRPPLDEGRPPLDPGRP-GPGR 276 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,835,810 Number of Sequences: 59808 Number of extensions: 395718 Number of successful extensions: 1618 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1607 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -