BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F08 (746 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain... 32 0.35 At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain... 32 0.35 At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain... 32 0.35 At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain... 32 0.35 At1g24220.1 68414.m03054 paired amphipathic helix repeat-contain... 31 0.61 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 30 1.9 At2g26060.1 68415.m03129 transducin family protein / WD-40 repea... 30 1.9 At5g22450.1 68418.m02618 expressed protein 29 2.5 At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 29 2.5 At2g47070.1 68415.m05881 squamosa promoter-binding protein-like ... 29 2.5 At3g04240.1 68416.m00448 O-linked N-acetyl glucosamine transfera... 29 3.3 At2g25870.1 68415.m03105 haloacid dehalogenase-like hydrolase fa... 29 3.3 At1g07160.1 68414.m00762 protein phosphatase 2C, putative / PP2C... 29 3.3 At4g32990.1 68417.m04692 transducin family protein / WD-40 repea... 29 4.3 At3g25250.1 68416.m03154 protein kinase family protein contains ... 28 5.7 At5g53440.1 68418.m06641 expressed protein 28 7.6 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 28 7.6 At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) fa... 28 7.6 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 28 7.6 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 28 7.6 >At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 590 ARSGRGPPPRSAAASTLASESDTRQRTTLPPRSP 489 A S + PPP + +ST S S T T+ PRSP Sbjct: 119 AGSKKSPPPLALPSSTTTSSSSTTSSTSSSPRSP 152 >At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 218 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 590 ARSGRGPPPRSAAASTLASESDTRQRTTLPPRSP 489 A S + PPP + +ST S S T T+ PRSP Sbjct: 141 AGSKKSPPPLALPSSTTTSSSSTTSSTSSSPRSP 174 >At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 590 ARSGRGPPPRSAAASTLASESDTRQRTTLPPRSP 489 A S + PPP + +ST S S T T+ PRSP Sbjct: 119 AGSKKSPPPLALPSSTTTSSSSTTSSTSSSPRSP 152 >At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 32.3 bits (70), Expect = 0.35 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 590 ARSGRGPPPRSAAASTLASESDTRQRTTLPPRSP 489 A S + PPP + +ST S S T T+ PRSP Sbjct: 119 AGSKKSPPPLALPSSTTTSSSSTTSSTSSSPRSP 152 >At1g24220.1 68414.m03054 paired amphipathic helix repeat-containing protein weak similarity to transcription co-repressor Sin3 [Xenopus laevis] GI:4960210; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 744 Score = 31.5 bits (68), Expect = 0.61 Identities = 18/75 (24%), Positives = 31/75 (41%) Frame = +2 Query: 200 RRTKPGTRASVLDPVTKQNIPPKPESKLAPLAPYVSPREQTRARVLSTVGQRERAFEADP 379 + T P + + P + IPPK + A PRE R R++ + ++ E Sbjct: 587 KATIPPKSSRTISPKANRTIPPKSKKTFPREAKRTIPREANRNRIMPSEAKKTIHPEDKR 646 Query: 380 LGTPRDHMDVLLAQA 424 P DH+ + +A Sbjct: 647 TTRPVDHLAFFIPKA 661 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/54 (33%), Positives = 21/54 (38%) Frame = +2 Query: 149 PFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAPLAPYVSP 310 P P P P P T + P V P K++ P P L P AP SP Sbjct: 90 PPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSP 143 >At2g26060.1 68415.m03129 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to WD40-repeat containing protein Ciao 1 (SP:O76071) [Homo sapiens] Length = 352 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 79 HDASALQVHLQRDAVDARGLGEGAVRAAAESRARPGDG 192 HD + H RD + A G G+ A+R +S+ DG Sbjct: 266 HDRTIYSAHWSRDDIIASGAGDNAIRLFVDSKHDSVDG 303 >At5g22450.1 68418.m02618 expressed protein Length = 1180 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 201 RPKAVT-GSGTRLGRGTNGTFSQSPSVDRV 115 RPK + GSG L RGT G S +P++ +V Sbjct: 22 RPKGIMLGSGNNLSRGTIGLSSDTPNLSQV 51 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 29.5 bits (63), Expect = 2.5 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 3/74 (4%) Frame = +2 Query: 98 RSTYSVTRSTLGDWEKVPFVPRPSLVPDPVTAF---GRRTKPGTRASVLDPVTKQNIPPK 268 RS+ S RS + D +K + S V + V + ++ T A++ DPV +Q+ P Sbjct: 477 RSSSSCLRSEVKDEKKTDTLDTESCVKELVESSMVGAIESRSSTHATIEDPVCEQSPSPS 536 Query: 269 PESKLAPLAPYVSP 310 P +P +P SP Sbjct: 537 PSPSPSP-SPSPSP 549 >At2g47070.1 68415.m05881 squamosa promoter-binding protein-like 1 (SPL1) identical to squamosa promoter binding protein-like 1 [Arabidopsis thaliana] GI:5931655; contains Pfam profile PF03110: SBP domain Length = 881 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -3 Query: 417 ASSTSMWSRGVPRGSASNARSRCPTVESTRAR--VCSRGDT*GARGANFDSGFGGMF 253 A+ T+ + P G++SN+ S C + + R V +GDT GA N + G+F Sbjct: 39 ATQTTRGRQFFPLGNSSNSSSSCSDEGNDKKRRAVAIQGDTNGALTLNLNGESDGLF 95 >At3g04240.1 68416.m00448 O-linked N-acetyl glucosamine transferase, putative similar to O-GlcNAc transferase, Homo sapiens [SP|O15294], Rattus norvegicus [SP|P56558]; contains Pfam profile PF00515: TPR Domain; identical to cDNA GI:18139886 Length = 977 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 160 RHERHLLPVPERRPRHAVGGPVGPTRRVEVTLVYHG*CSCYRSGF 26 R + ++ +P +P HA+ P+ P +E++ Y CS S F Sbjct: 526 RRQINMSVLPSVQPFHAIAYPIDPILALEISRKYAAHCSIIASRF 570 >At2g25870.1 68415.m03105 haloacid dehalogenase-like hydrolase family protein contains Pfam profiles PF00702: haloacid dehalogenase-like hydrolase, PF02130: Uncharacterized protein family UPF0054 Length = 584 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 95 YRSTYSVTRSTLGDWEKVPFVP 160 +R ++ RST+GDW K+P P Sbjct: 58 FRRSFHALRSTVGDWRKLPKPP 79 >At1g07160.1 68414.m00762 protein phosphatase 2C, putative / PP2C, putative similar to protein phosphatase 2C GI:2582800 from [Medicago sativa] Length = 380 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/60 (35%), Positives = 29/60 (48%) Frame = +2 Query: 149 PFVPRPSLVPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAPLAPYVSPREQTRA 328 PF R L P FG + PG+ P T +IP P AP++ +PRE++RA Sbjct: 58 PFCLR-LLKPPAKLGFGSDSGPGSILKRKRPTTL-DIPVAPVGIAAPISNADTPREESRA 115 >At4g32990.1 68417.m04692 transducin family protein / WD-40 repeat family protein HIRA protein, Drosophila melanogaster, PID:e1250847 Length = 318 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 79 HDASALQVHLQRDAVDARGLGEGAVRAAAESRARPGDG 192 HD + VH RD V A G G+ ++ +S + DG Sbjct: 242 HDRTIYSVHWSRDGVIASGAGDDTIQLFVDSDSDSVDG 279 >At3g25250.1 68416.m03154 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 421 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +2 Query: 134 DWEKVPFVPRPSLVPDPVTAFGRRTKPGTRASV 232 DWEKV V RP +P P + T T+ V Sbjct: 333 DWEKVILVSRPPYIPAPDDGGDKGTDVNTKMDV 365 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 254 NIPPKPESKLAPLAPYVSPREQTRARVLSTVGQRERAFEADPLGTPRDHM 403 + PP+PES+ +P V PRE+ ++T G+ +R +G + +M Sbjct: 596 SFPPRPESRSGVSSPRVGPREEDNR--VNTGGRYKRGGVDAMMGRGQSNM 643 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 27.9 bits (59), Expect = 7.6 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = +2 Query: 20 ASETRTITRALTMVYESDFYTTRRPYRSTYSVTRSTLGDWEKVPFVPRPSLVPDPVTAFG 199 AS I +L + +D+Y P T V + TL P V +P+L P PV Sbjct: 6 ASFAICILLSLATIATADYYAPSSPPVYTSPVNKPTLPPPVYTPPVHKPTL-PPPV---- 60 Query: 200 RRTKPGTRASVLDPV-TKQNIPP 265 T P + ++ PV TK +PP Sbjct: 61 -YTPPVHKPTLSPPVYTKPTLPP 82 >At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 327 Score = 27.9 bits (59), Expect = 7.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 239 PVTKQNIPPKPESKLAPLAPYVSPRE 316 PV + ++PPKP S L P++ P + Sbjct: 167 PVCRASLPPKPGSDQNSLYPFIRPHD 192 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/61 (27%), Positives = 20/61 (32%) Frame = -2 Query: 250 FGDGVQHGGARARLGAPPEGRHRVGHETRPRHERHLLPVPERRPRHAVGGPVGPTRRVEV 71 F + V H L P H H P H H P P P PV P + V Sbjct: 23 FTEEVNHKTQTPSLAPAPAPYHHGHHHPHPPHHHH--PHPHPHPHPPAKSPVKPPVKAPV 80 Query: 70 T 68 + Sbjct: 81 S 81 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/48 (33%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +2 Query: 149 PFVPRPSL-VPDPVTAFGRRTKPGTRASVLDPVTKQNIPPKPESKLAP 289 P P+P P PV G KP + PPKPE+K P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,510,087 Number of Sequences: 28952 Number of extensions: 254180 Number of successful extensions: 1130 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1122 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -