BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F07 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36998| Best HMM Match : TUDOR (HMM E-Value=0) 29 2.8 SB_58212| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-38) 28 6.4 >SB_36998| Best HMM Match : TUDOR (HMM E-Value=0) Length = 2538 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 7/61 (11%) Frame = -3 Query: 347 MCVLGRANGDPSWWKRKPASLERNKS-------GNSKTCQHLSAKMIANEFS*LHDKLFF 189 +C R D SW++ + + RN GNS+T + KM+A++F+ L +++ Sbjct: 921 VCCAARYTEDDSWYRARILEVSRNTVTVQYIDYGNSETLPNNRLKMLASKFAELPEQVVP 980 Query: 188 C 186 C Sbjct: 981 C 981 >SB_58212| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-38) Length = 352 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 416 LLCQTDLLVCYFYIMT*RNKEM*MCVLGRA-NGDPSWWKRKPASL 285 LLC +L CYF I+ +C G+A NGD KRK L Sbjct: 195 LLCSITMLYCYFNIIKGLYFTQTICSRGQAPNGDERAAKRKIVKL 239 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,133,882 Number of Sequences: 59808 Number of extensions: 394225 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -