BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F07 (703 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011457-1|AAR99115.1| 323|Drosophila melanogaster RE31995p pro... 29 6.1 BT003627-1|AAO39631.1| 295|Drosophila melanogaster AT31631p pro... 29 6.1 AE014297-4303|AAF56843.1| 323|Drosophila melanogaster CG14517-P... 29 6.1 >BT011457-1|AAR99115.1| 323|Drosophila melanogaster RE31995p protein. Length = 323 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 6 RPMGGAAGFSTSRVVPLREXWEQVKALLKXVLHILYEYLKXFEV 137 RP G A +ST+ +VP R+ EQ+ A L + + L + L + + Sbjct: 101 RPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRI 144 >BT003627-1|AAO39631.1| 295|Drosophila melanogaster AT31631p protein. Length = 295 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 6 RPMGGAAGFSTSRVVPLREXWEQVKALLKXVLHILYEYLKXFEV 137 RP G A +ST+ +VP R+ EQ+ A L + + L + L + + Sbjct: 73 RPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRI 116 >AE014297-4303|AAF56843.1| 323|Drosophila melanogaster CG14517-PA protein. Length = 323 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 6 RPMGGAAGFSTSRVVPLREXWEQVKALLKXVLHILYEYLKXFEV 137 RP G A +ST+ +VP R+ EQ+ A L + + L + L + + Sbjct: 101 RPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRI 144 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,522,716 Number of Sequences: 53049 Number of extensions: 581544 Number of successful extensions: 864 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3087795150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -