BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_F04 (736 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 3.0 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 3.0 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 23.0 bits (47), Expect = 3.0 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = -2 Query: 570 TVIVSSIFISNLASCFATTVLSTFNESSIPVTANYSVIQPRAIYIPHTIFGIFPRIVF 397 TVI + IF++ L +T V+ N+S T NY + + I G+ P I + Sbjct: 57 TVIYAVIFVTGLVGNVSTCVVIARNKSMHTAT-NYYLFSLAVSDLLLLISGLPPEIYY 113 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.0 bits (47), Expect = 3.0 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 307 YELYSRCGDIRRVIMG-LDKYKKTPCGFCFVE--YYAREDAE 423 Y+L + R+ LDKYK TP G E + AR AE Sbjct: 119 YDLLENVNNAARINWEYLDKYKPTPLGAVATEKMFVARHLAE 160 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,871 Number of Sequences: 438 Number of extensions: 4132 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -