BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fcaL-P02_F_E22 (803 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 25 0.53 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 6.6 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.7 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 25.4 bits (53), Expect = 0.53 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +2 Query: 647 LNLKNDHLRKRFDALKYDVKKIEEVVY 727 L +N HL+ D LK +++K++++VY Sbjct: 170 LERENCHLKFVTDTLKKELEKLQKIVY 196 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 296 PSQKVDELCHMPEKCRLHCSVLLGALWSLPEI 201 PSQ + E PE+ + ++G +SLP + Sbjct: 453 PSQYIHEPWTAPEQVQRAAKCIIGKDYSLPMV 484 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +2 Query: 317 LKDAVPPTDYFKYQDHWRFMTQRYCY 394 +KD+VP T + + W + CY Sbjct: 49 VKDSVPMTCRYTFLLEWYHTLSKACY 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,805 Number of Sequences: 336 Number of extensions: 3898 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -